KEGG   Desulfovibrio aespoeensis: Daes_1223Help
Entry
Daes_1223         CDS       T01382                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daes_1223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_1223
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Daes_1223
Enzymes [BR:das01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Daes_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1396397..1397845)
Genome map
AA seq 482 aa AA seqDB search
MTADLFPTYRGRMEYFCLGCGQRYPADELYYTCPECGGVFLLDNLDFNELKKTPGEEWRR
IFDARAASKRTALRGVFRFYELMAPVLEEEDIVYLGEGNTPLVESSPGLNAATGLRTAYK
NDGQNPSASFKDRGMACGFSYLRALIRKHGWDSILTVCASTGDTSAAAALYASYVGGAIT
SVVILPHGKVTPAQLAQPLGSGAVVLEVPGVFDDCMKVVEHLADNYRVALLNSKNAWRIL
GQESYAFEVAQWFDWDLRDTCIFVPIGNAGNITAIMAGFLKLHELDVITSLPRIFGVQSH
HADPVYRYYAVDDPKERHYRPVTVTPSVAQAAMIGNPVSFPRVRHFAEKFEAVAGADAFQ
VIQVTEQQIMDSMIQANRNGHIACTQGGESFAGAKRALELGLVSPDELCVLDSTAHQLKF
VDFQTMYFENAFPPEFEVVPDMALANKPALVISPEDKARLSPEEFTRTTAENIVARLGLE
KK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgatctcttccccacctatcgcggacgcatggaatacttctgtctcggatgc
ggccagcggtaccccgccgacgagttgtattacacctgccccgagtgcggcggcgtgttc
ctgctcgacaacctcgacttcaacgaactgaagaagacgccgggcgaagagtggcgaaga
atcttcgacgcgcgcgctgcctccaagcgcaccgcgctgcgcggcgtgttccggttctac
gaactgatggctccggtgctggaggaggaggacatagtctacctgggtgagggcaacacc
ccgctggtggaatcatccccagggctcaacgcggccacgggtctgcgcaccgcctacaag
aacgatggccagaacccgtccgcgtctttcaaggaccggggcatggcctgtggcttctcc
tacctgcgcgccctcatccgcaagcacggctgggactccatcctcacggtctgcgcctcc
acgggcgacacctcggcggctgcggccctctacgcctcttatgtgggcggggccatcacc
tcggtggtcatcctgccccacggcaaggtcaccccggcccagctcgcccagccgctcggc
tcgggcgcggtggtgctcgaagtgccgggcgtgttcgacgactgcatgaaggtggtcgag
catctggccgacaactaccgcgtggccctgctcaactccaagaacgcctggcgcatcctc
ggccaggaatcctacgcctttgaggtcgcccagtggttcgactgggatttgcgcgacaca
tgcatcttcgtgcccatcggcaacgcgggcaacatcacggccatcatggccggattcctc
aagcttcacgaacttgacgtcatcaccagcctgccgcgcatcttcggcgtccagtcgcac
catgcggacccggtctaccgctactacgccgtggacgaccccaaggagcggcactaccgc
cccgtgaccgtgaccccgtccgtggcccaggcggccatgatcggcaacccggtctccttc
ccgcgcgtgcgccactttgccgagaaattcgaggccgtggcaggtgccgacgccttccag
gtgatccaggtgaccgagcagcagatcatggattccatgatccaggccaaccgcaacgga
cacatcgcctgtacccagggtggcgaatcctttgccggggccaagcgcgccctggagctt
gggctggtctcgcccgacgaactgtgcgtgctcgactccacggcccaccagctcaagttt
gtggatttccagaccatgtatttcgaaaacgccttcccgccggagtttgaggtggtgccg
gacatggccctggccaacaagcccgcgctggtcatctcgcccgaggacaaggcgcgcctc
tcgcccgaggaattcacccggaccacggcggagaacatcgtcgcccggctgggactggag
aagaagtag

DBGET integrated database retrieval system