KEGG   Pseudodesulfovibrio aespoeensis: Daes_1256Help
Entry
Daes_1256         CDS       T01382                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00790  Folate biosynthesis
das01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daes_1256
Enzymes [BR:das01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Daes_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADU62270
JGI: Daes_1256
UniProt: E6VUM9
Position
1432577..1433431
Genome map
AA seq 284 aa AA seqDB search
MIDTTWTVKGGRVLGPAPFFIAGIVNVTPDSFYDGGAHGVVGKAVAHGLTLARQGAHILD
VGGESTRPYAETVPAEAEIARVLPVIEGLLASDELSGGSAPAISVDTTKAVVAARALDAG
AVILNDVSAFSYDPALADVIAQYRPGYVLMHSLGRPGTMQDSPRYADVVDEVMAFFGEKL
ERLDALGLPGDRIVLDPGIGFGKTLEHNLTILRGIERFKAFGLPVFMGLSNKSLWQGLLG
LPVDRRQNATQAATAIMAAKGVPIHRVHEVESTRQTLTIVHQIA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacacgacatggacagtgaaggggggcagggtcttgggccccgccccctttttc
attgccgggatcgtcaacgtgaccccggattccttctatgacgggggggcgcatggtgtg
gtcgggaaggccgtggcccacgggctgaccctggcccgccagggcgcgcacatcctcgac
gtgggcggcgagtccacccggccctatgccgagactgttccggcagaggccgagattgcg
cgggtgctgccggtcatcgaggggctgctggcgtcggacgagctgtcaggcgggtcggcc
ccggccatttcggtggacaccaccaaggccgtggttgccgccagggcgctcgatgccggg
gcggtcatcctcaacgacgtgtccgccttttcctatgacccggccctggccgatgtcatt
gcccagtacaggcccggctacgtgctcatgcacagtctgggcaggccagggaccatgcag
gattccccgcggtatgcggatgtggtggacgaggtcatggcctttttcggggagaagctt
gagcggctcgacgcgctggggctgccaggggaccggatcgtgctcgatccgggtatcggg
ttcggcaagacccttgaacacaacctgaccatcctgcggggcattgagcggttcaaagcc
tttgggctgcctgtgttcatggggctttccaacaaatccctgtggcagggactgctcggc
ctgcctgttgacaggcggcagaacgccacccaggcggccacggcgatcatggcggcgaag
ggcgtgcccatccaccgtgttcatgaggtggaatcgacacgacaaacattgaccatcgtt
catcaaatagcgtag

DBGET integrated database retrieval system