KEGG   Desulfovibrio aespoeensis: Daes_1260Help
Entry
Daes_1260         CDS       T01382                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
das  Desulfovibrio aespoeensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Daes_1260
   00052 Galactose metabolism
    Daes_1260
   00500 Starch and sucrose metabolism
    Daes_1260
   00520 Amino sugar and nucleotide sugar metabolism
    Daes_1260
Enzymes [BR:das01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Daes_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1436509..1437381
Genome map
AA seq 290 aa AA seqDB search
MEITKAVIPVAGWGTRSLPATKNVPKEMLPIFRKPIVQYIVEEGIGAGITDVVFVTNQNK
TIIEDHFDRNFLLEQLLARADKLDMLEEVRRVADMVNVIAVRQKEQLGLGHAVLTAREVC
KNEPFAVMLGDDLMFGRDTGIGELIKAAKIENKAVVGVIEVPKSKVSKYGVIKGTEFAKG
MYTVSSLVEKPSVEQAPSNLAIIGRYVLLPEIFDILEDQKAGVGGEIQLTDALQGLADRD
KLIAVKLQGQRFDAGDWVEYLTANIYFALQDEELRDELVKRLQELLSCPS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcacaaaggccgttattcccgtcgctggctggggcacccgctcccttcccgca
accaagaacgttcccaaggagatgctgcccatcttccgcaagcccatcgtccagtacatc
gtggaggagggcattggcgcgggcatcacggacgtggtctttgtcaccaaccagaacaag
accatcatcgaggaccatttcgaccgcaacttcctgctggagcagctcctggcccgcgcg
gacaagctggacatgctggaggaggtccgccgcgtggccgacatggtcaacgtcatcgcc
gtgcgccagaaggagcagctgggccttggccacgccgtgctcacggcccgcgaggtgtgc
aagaacgagccgttcgcggtcatgctgggcgacgatctcatgttcgggcgcgacaccggc
atcggcgagctgatcaaggccgccaagatcgagaacaaggccgtggtcggcgtcatcgag
gtgccgaaaagcaaggtcagcaaatacggcgtgatcaagggcaccgagtttgccaagggc
atgtacacggtctcaagtctggtggagaagccctcggtggagcaggccccgtccaacctc
gccatcatcgggcgctatgtcctgctgccggagattttcgacatcctcgaagaccagaag
gcgggcgtgggcggcgagatccagttgaccgacgcccttcaggggctggcagatcgcgac
aagctcatcgcggtcaagctccaggggcagcgttttgatgctggcgactgggtggaatac
ctgacggccaatatctacttcgccctccaggacgaggaactgcgcgacgaactcgtcaag
cggctccaggagttgctctcttgcccaagctga

DBGET integrated database retrieval system