KEGG   Pseudodesulfovibrio aespoeensis: Daes_1327Help
Entry
Daes_1327         CDS       T01382                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00030  Pentose phosphate pathway
das01100  Metabolic pathways
das01120  Microbial metabolism in diverse environments
das01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Daes_1327
Enzymes [BR:das01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Daes_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADU62341
JGI: Daes_1327
UniProt: E6VV97
Position
complement(1497873..1499600)
Genome map
AA seq 575 aa AA seqDB search
MPKILRINTRTKAYTYEDAGKYANLGGRALTSRIINTEVPADCHPLSAENKVVIATGLLG
GSTAANSGRLSVGVKSPLTNGIKESNSGGLFAHKMPKMDLLAIILEDRPEEGAPFSTLFI
TDGKVIFKDATPIVGMDNYPAHDKLLAEYGDKMIAGMIGPAGETLRKTATIQFTDPYKRP
ARSAGRGGTGAVMGSKKIKAIVLDPEVNTKVGAVDAEAFKTARKTWVDILQGHPVTSQGL
PGFGTSILVNVVNEAGALPGKNFRLGQIDHAADISGEKIAELITARGGKTTEGCHVGCVI
QCSQQYNNAKGEYVTSGFEYETVWALGANAMIKDIDDIAAIDRLCDEKGMDTIEMGNTVA
IAMDGGIIPWGDGKAAFELLSKVGTKDPMGMIMGNGVDFAGGAFGVDRLPTVKGQSMPAY
DPRAVKGVGVTYATSAMGADHTAGYGVAQNILKVGGDIDGLKKEGNVELSKNLQIATAAI
DSMGFCLFVAFAVLDAPNGVQAMADLVQAYTGKPFTSDDLVNLGVNCLKDEQAFNERAGF
TKMDDKLPRFFETDPLPPHGVVWDLSVDELQGAKV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagattctgaggatcaacacccgcaccaaagcgtacacctatgaggacgccggc
aagtacgccaacctcggcggtcgcgccctgacctcccgcatcatcaacaccgaagtcccg
gcagactgccaccccctgtcggcggagaacaaggtcgtcatcgccacgggcctgctcggc
ggctccaccgccgccaactcgggccgcctctcggtcggcgtcaagtccccgctgaccaac
ggcatcaaggagtccaactccggcggtctctttgcccacaagatgcccaagatggacctg
ctggctatcatcctcgaagaccggcccgaggagggcgcgcccttctccaccttgttcatc
accgacggcaaggtgatcttcaaggacgccacccccatcgtgggcatggacaactacccg
gcccacgacaagctcctggccgaatacggcgacaagatgatcgcgggcatgatcggaccc
gcaggcgagaccctgcgcaagaccgccaccatccagttcaccgatccctacaagcgcccg
gcgcgctcggctggccgcggcggcaccggcgcagtcatgggttccaagaagatcaaggcc
atcgtccttgatcccgaggtcaacaccaaggtgggcgctgtcgatgccgaggccttcaag
accgcccgcaagacctgggtggacatcctccagggccatccggtcaccagccaggggctg
cccggtttcggcacctccatcctggtcaacgtggtcaacgaggcgggcgccctgccgggc
aagaacttccgcctgggtcagatcgaccacgccgccgacatctcgggcgagaagatcgcc
gagctcatcaccgcgcgcggcggcaagaccaccgagggctgccacgtgggctgtgtcatc
cagtgctcccaacagtacaacaacgccaagggcgagtacgtgacctccggcttcgagtac
gagacggtctgggccctgggcgccaacgccatgatcaaggacatcgacgacatcgccgcc
atcgaccgtctctgtgacgagaagggcatggacaccatcgagatgggcaacaccgtggcc
atcgccatggacggcggcatcatcccctggggcgacggcaaggccgccttcgagctgctc
tccaaggtcggcaccaaggaccccatgggcatgatcatgggcaacggcgtggatttcgcg
ggcggcgccttcggcgttgaccggctgcccacggtcaagggccagtccatgcccgcctac
gatccgcgcgcggtcaagggcgtgggcgtcacctacgccacctcggccatgggcgcggac
cacaccgccggttacggcgtggcccaaaacatcctcaaggtgggcggcgacatcgacggc
cttaagaaagaaggcaacgtcgagctctccaagaaccttcagatcgccacggcggccatc
gactccatgggtttttgcctctttgtcgcctttgccgtgctcgacgcccccaacggcgtg
caggccatggccgatctggtccaggcatacaccggcaagcctttcacctccgacgatctg
gtcaacctgggcgtcaactgcctcaaggacgaacaggccttcaacgagcgcgccgggttc
accaagatggacgacaagctgccccgcttcttcgagaccgatcccctgccgccccatggc
gtggtctgggatttgagcgtggacgagcttcagggcgccaaggtctaa

DBGET integrated database retrieval system