KEGG   Desulfovibrio aespoeensis: Daes_1428Help
Entry
Daes_1428         CDS       T01382                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daes_1428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_1428
   00052 Galactose metabolism
    Daes_1428
   00500 Starch and sucrose metabolism
    Daes_1428
   00520 Amino sugar and nucleotide sugar metabolism
    Daes_1428
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daes_1428
   00524 Butirosin and neomycin biosynthesis
    Daes_1428
Enzymes [BR:das01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Daes_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1599709..1600659
Genome map
AA seq 316 aa AA seqDB search
MAIILAADIGGTNSRFALFDTAGGALVMERSLWLKTHEAASFADLLDQVRASGFPLSGVI
DAAVLAVAGAVHGGVQCRLPNAPWGVDLREVDLGTPTACLINDFAAQAYACRTTAVAEAQ
VIQAGEPEPGAVVGVIGAGTGLGHSALIPDGDRWVALSSEAGHMSFPFTGPEEAVYEEFN
RTASGRNWAEGDTVVTGLGLRLVHQHLTGENLSPDVISARITVESPTTQWFARFYGRACR
NWAMALMARGGLFIAGGVAARNPMLVTAPEFLDEFHNSHVHGEYLRSVPIRLNANQESGL
YGAAFHGAQLLHGGKE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgataatcctggccgccgacatcggcggcaccaacagccggttcgcactcttcgac
accgcaggcggcgcactggtcatggagcgctccctctggctgaagactcacgaggccgcg
tcctttgccgatctgctcgatcaggtccgggccagcgggttccccctgtccggcgtcatc
gacgctgcggtgctggccgtggccggggcggtgcatggcggggtccaatgccgcctgccc
aacgcgccctggggcgtggacctgcgcgaggtggacctggggacccccacagcgtgtctg
atcaatgatttcgcggcccaggcctatgcctgccgcaccaccgccgttgccgaggcgcag
gtcatccaggccggggagccggagccgggagctgtggtcggggttatcggcgcgggcacc
gggctggggcactcggctctgatccctgacggcgaccggtgggttgcgctctcgtccgag
gccggacacatgagcttcccgttcaccggcccggaagaagccgtgtacgaggagttcaac
cgcacggcctccgggcgcaactgggccgagggcgacacggtggtcacggggctggggctg
cgtctcgtccatcagcatctcacgggcgagaatctgtcgcccgacgtgatttccgccagg
attacagtggagagcccgaccacacagtggtttgcccgcttctacggcagggcgtgccgc
aactgggccatggccctgatggcgcgcggcgggctgtttatcgcgggtggcgtggccgcc
aggaaccccatgctcgtcactgcaccggagttcctggacgagttccacaactcgcatgtt
cacggcgagtacctgcgctccgtgccgatccggctcaacgccaaccaggagagcggtctc
tacggcgctgcctttcacggcgcgcaactcctgcacggggggaaggaatga

DBGET integrated database retrieval system