KEGG   Pseudodesulfovibrio aespoeensis: Daes_1444Help
Entry
Daes_1444         CDS       T01382                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:das00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daes_1444
DNA repair and recombination proteins [BR:das03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Daes_1444
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Daes_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR HHH HHH_5
Motif
Other DBs
NCBI-ProteinID: ADU62458
JGI: Daes_1444
UniProt: E6VW13
Position
1616765..1617370
Genome map
AA seq 201 aa AA seqDB search
MQNIPGPLREVVEQLSSLPGVGPKSALRMALTLLKMPRERANGVGQAILDLRENLCLCEE
CACLAEASPCAICADPSRETDQLCVVPEWDALLAMEDMGVFRGRYLVLGGLLSPLDGVSP
ANLETDRLRRHLRAGHVRELILALGATLDAEATASFIKNMVGADFSGITVSRLAQGIPMG
GEVKFMDRETLRQSLVHRQKV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaatattcccggcccgctcagggaggtggtggagcagctctccagcctccccgga
gtcggccccaagtcggccctgcgcatggcgctgaccctgctcaagatgccgcgcgagcgc
gccaacggcgtgggccaggccatcctcgacctgcgcgagaacctctgcctgtgcgaggag
tgcgcctgtctggccgaggccagcccctgcgccatctgcgcggacccgagccgcgagacg
gaccagctctgcgtggttcccgagtgggacgcgcttctggccatggaggacatgggcgtg
ttccggggccgctatctggtcctgggcggcctgctgtcgcctcttgatggcgtgtctccg
gccaacctggagaccgaccggctgcgccgccatctgcgcgccgggcatgtcagggagctg
atcctggccctgggcgcgacgctcgacgccgaggccacggcctcgttcatcaagaacatg
gtcggggcggatttttccggcatcacggtcagccgtctggcccagggaatccccatgggc
ggcgaggtcaagttcatggaccgggagacgcttcggcaatccctggtccacaggcagaaa
gtgtga

DBGET integrated database retrieval system