KEGG   Desulfovibrio aespoeensis: Daes_1444Help
Entry
Daes_1444         CDS       T01382                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
das  Desulfovibrio aespoeensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:das00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daes_1444
DNA repair and recombination proteins [BR:das03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Daes_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1616765..1617370
Genome map
AA seq 201 aa AA seqDB search
MQNIPGPLREVVEQLSSLPGVGPKSALRMALTLLKMPRERANGVGQAILDLRENLCLCEE
CACLAEASPCAICADPSRETDQLCVVPEWDALLAMEDMGVFRGRYLVLGGLLSPLDGVSP
ANLETDRLRRHLRAGHVRELILALGATLDAEATASFIKNMVGADFSGITVSRLAQGIPMG
GEVKFMDRETLRQSLVHRQKV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaatattcccggcccgctcagggaggtggtggagcagctctccagcctccccgga
gtcggccccaagtcggccctgcgcatggcgctgaccctgctcaagatgccgcgcgagcgc
gccaacggcgtgggccaggccatcctcgacctgcgcgagaacctctgcctgtgcgaggag
tgcgcctgtctggccgaggccagcccctgcgccatctgcgcggacccgagccgcgagacg
gaccagctctgcgtggttcccgagtgggacgcgcttctggccatggaggacatgggcgtg
ttccggggccgctatctggtcctgggcggcctgctgtcgcctcttgatggcgtgtctccg
gccaacctggagaccgaccggctgcgccgccatctgcgcgccgggcatgtcagggagctg
atcctggccctgggcgcgacgctcgacgccgaggccacggcctcgttcatcaagaacatg
gtcggggcggatttttccggcatcacggtcagccgtctggcccagggaatccccatgggc
ggcgaggtcaagttcatggaccgggagacgcttcggcaatccctggtccacaggcagaaa
gtgtga

DBGET integrated database retrieval system