KEGG   Pseudodesulfovibrio aespoeensis: Daes_1557Help
Entry
Daes_1557         CDS       T01382                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00010  Glycolysis / Gluconeogenesis
das00051  Fructose and mannose metabolism
das00562  Inositol phosphate metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
das01120  Microbial metabolism in diverse environments
das01130  Biosynthesis of antibiotics
das01200  Carbon metabolism
das01230  Biosynthesis of amino acids
Module
das_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
das_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_1557
   00051 Fructose and mannose metabolism
    Daes_1557
   00562 Inositol phosphate metabolism
    Daes_1557
Enzymes [BR:das01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daes_1557
Exosome [BR:das04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daes_1557
  Exosomal proteins of bladder cancer cells
   Daes_1557
  Exosomal proteins of melanoma cells
   Daes_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU62570
JGI: Daes_1557
UniProt: E6VX64
Position
complement(1737153..1737908)
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMFKTWDEAQATARGLVELAAAKLPQDREVLVCPPFTCLKAVSDAFSGVPG
FATGGQDFYFREEGAFTGEISPAMLRDVGAAYGLTGHSERRHVLGEDDAYIGQKTAFGLS
AGLRVILCIGELIDERRAGRVEEVLERQLRLGLKDVPLDVSPERISVAYEPVWAIGTGEV
AGPEEILAAHAFTRKTMAAILGKKANEMRILYGGSVKPSNCAEIIALDNVDGVLVGGASL
QSESFSQIVLA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattgatggccgccaactggaagatgttcaagacttgggacgaggcgcaggcc
acggcccgcggactggtcgagcttgctgcggcaaaactcccccaggatcgcgaagtgctt
gtctgcccgccgttcacctgtctcaaggcggtctcggacgcgttttcgggagtgcctggt
tttgccacgggcggccaggatttctatttcagggaagagggcgcgttcaccggcgagata
tcgcccgccatgctccgcgatgttggggcggcatacggcctgacaggccactcggagcgt
cgccatgtcctgggtgaggatgacgcctatattggccagaagaccgcgtttggcctgtcc
gccgggttgcgcgtcatcctgtgcatcggcgaactcatcgatgaacgcagggcgggccgc
gtggaagaggtcctggagcgccagctgcgcctgggcctgaaggacgtgcccctggatgtc
tcgcccgaaagaatcagcgtggcctacgagcctgtctgggccatcggcaccggcgaggtg
gccgggcctgaggagattcttgcggcccacgcctttacccgaaaaaccatggccgccatc
cttggcaaaaaagccaatgaaatgcgcatattgtacggaggcagcgtcaagccttccaac
tgcgccgagattattgcgcttgacaatgtcgacggtgtcttggtaggaggcgcgagcttg
cagagcgaaagcttttctcagatcgttctggcctga

DBGET integrated database retrieval system