KEGG   Desulfovibrio aespoeensis: Daes_1557Help
Entry
Daes_1557         CDS       T01382                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daes_1557
   01230 Biosynthesis of amino acids
    Daes_1557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_1557
   00051 Fructose and mannose metabolism
    Daes_1557
   00562 Inositol phosphate metabolism
    Daes_1557
Enzymes [BR:das01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daes_1557
Exosome [BR:das04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daes_1557
  Exosomal proteins of bladder cancer cells
   Daes_1557
  Exosomal proteins of melanoma cells
   Daes_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1737153..1737908)
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMFKTWDEAQATARGLVELAAAKLPQDREVLVCPPFTCLKAVSDAFSGVPG
FATGGQDFYFREEGAFTGEISPAMLRDVGAAYGLTGHSERRHVLGEDDAYIGQKTAFGLS
AGLRVILCIGELIDERRAGRVEEVLERQLRLGLKDVPLDVSPERISVAYEPVWAIGTGEV
AGPEEILAAHAFTRKTMAAILGKKANEMRILYGGSVKPSNCAEIIALDNVDGVLVGGASL
QSESFSQIVLA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattgatggccgccaactggaagatgttcaagacttgggacgaggcgcaggcc
acggcccgcggactggtcgagcttgctgcggcaaaactcccccaggatcgcgaagtgctt
gtctgcccgccgttcacctgtctcaaggcggtctcggacgcgttttcgggagtgcctggt
tttgccacgggcggccaggatttctatttcagggaagagggcgcgttcaccggcgagata
tcgcccgccatgctccgcgatgttggggcggcatacggcctgacaggccactcggagcgt
cgccatgtcctgggtgaggatgacgcctatattggccagaagaccgcgtttggcctgtcc
gccgggttgcgcgtcatcctgtgcatcggcgaactcatcgatgaacgcagggcgggccgc
gtggaagaggtcctggagcgccagctgcgcctgggcctgaaggacgtgcccctggatgtc
tcgcccgaaagaatcagcgtggcctacgagcctgtctgggccatcggcaccggcgaggtg
gccgggcctgaggagattcttgcggcccacgcctttacccgaaaaaccatggccgccatc
cttggcaaaaaagccaatgaaatgcgcatattgtacggaggcagcgtcaagccttccaac
tgcgccgagattattgcgcttgacaatgtcgacggtgtcttggtaggaggcgcgagcttg
cagagcgaaagcttttctcagatcgttctggcctga

DBGET integrated database retrieval system