KEGG   Desulfovibrio aespoeensis: Daes_1838Help
Entry
Daes_1838         CDS       T01382                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
das  Desulfovibrio aespoeensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Daes_1838
Enzymes [BR:das01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Daes_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2024112..2025434)
Genome map
AA seq 440 aa AA seqDB search
MLPQEIIRAKRDGRPLSDEEITQFVAGMTDGTITEGQVAALGMAVYFQGMTGRESAALTL
AMARSGAMLSWDVDGPVLDKHSSGGVGDLVSLALGPMVAACGGYVPMVSGRGLGHTGGTL
DKLESIPGYRTMPGREEFRRAVLGAGVAIIGQTDDLAPADRIFYAVRDVTATVESIPLIT
ASILSKKLAAGLHGLVMDIKAGCGAFMPTFEQAEALARSIVSVAAGAGLPTVALITSMDE
PLAPCAGNAVEVREAVRYLTCAARDPRLHAVTMALGGRMLTLGGLAGDEAAARAMLERAL
DSGAAAERFSRMVAALGGPVDFIEACDRYLPRARTTLPVLATRGGRLAAWDTRALGLAVV
ELGGGRTAAGQGVDHSVGLTDIARTGQCVRAKDVLAVVHAASPAMAEAVRDRVLAAAVID
PMSEEGAPQDPVSVVLGCCE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccaggagatcatccgggccaagcgcgatggccgtccgctgtccgacgaggaa
ataacccagtttgtcgcgggcatgaccgatggcaccatcaccgagggacaggtggccgcc
ctgggcatggccgtgtattttcagggcatgaccgggcgggagagcgcggccctgaccctg
gccatggcccgttccggggcgatgctgtcctgggacgtggacggcccggtgctcgacaag
cattccagcggcggggtgggcgatctggtcagcctggcgcttggccccatggtggcggcc
tgcggcggctatgtgcccatggtctctggccgggggctgggccacacgggcggcaccctg
gacaagcttgaatccattccgggctatcggaccatgccgggtcgcgaggaattccggcgg
gcggtcctgggagccggggtggccatcatcggccagaccgacgatctggctccggcggac
aggatattctacgcggtccgcgatgtcacggccacggtggagtcgatcccgcttatcacc
gcctccatcctctcgaaaaaactggccgccgggctccacgggctggtcatggacatcaag
gccgggtgcggggcgttcatgcccacctttgaacaggctgaggcgctggcccgcagcatc
gtcagcgtggccgccggggccgggctgcccaccgtcgcgctgatcacgtccatggacgag
ccgttggccccgtgcgcaggcaatgcggtggaggtgcgcgaggccgtgcgctacctgacc
tgtgcggcgcgcgacccccggctgcatgccgtgaccatggccctgggcgggcggatgctg
acgctgggcgggctggccggagacgaggccgcggccagggccatgctggagcgcgccctg
gacagcggcgcggctgcagagcggttttcgcgcatggtcgctgccctgggcggcccagtg
gacttcatcgaggcctgtgatcggtacctgcccagggcgcggacaacgttgcccgtcctg
gccacgcgcggcgggcgtctcgcggcctgggacacgcgcgccctggggctggccgtggtg
gaactagggggcggacggaccgcagccgggcagggcgtggatcattcggtcgggctgacc
gatatcgcccggaccgggcagtgcgtgcgggccaaagacgtgctggccgtggtccatgcc
gcgtcgcccgccatggccgaggcggtgcgggacagggtgctggccgctgccgtcattgat
cccatgtctgaagagggtgcgccccaagaccccgtgtccgtggtcttgggctgttgcgag
tga

DBGET integrated database retrieval system