KEGG   Desulfovibrio aespoeensis: Daes_1875Help
Entry
Daes_1875         CDS       T01382                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
das  Desulfovibrio aespoeensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:das00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daes_1875
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Daes_1875
Enzymes [BR:das01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Daes_1875
Two-component system [BR:das02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Daes_1875
Bacterial motility proteins [BR:das02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Daes_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2075324..2076379)
Genome map
AA seq 351 aa AA seqDB search
MIKVLVVDDSAFMRKAISTMLGKDPGIKVVGTARDGLEGLEMVRKLNPDVVTMDIEMPRM
DGLTALRHIMMEAPRPVLMVSSLTTEGAEATLKAMELGAVDFIPKQLSKVSLDIVKIEKD
LIARVKTVAARKMRHVPSRAAAPRPAAPQAPRVAVTPGGRPLRDVVAIGVSTGGPPVVQK
ILSSLPADFPASIVIAQHMPAAFTGPFAKRLDSVSKITVKEAENGDVLRPGFAYVAPGGR
HIILDQRVSRVDVVVTDEPADALYKPSANVLISSVAQAVGKRGLGVILTGMGSDGCEGVR
ELKERGGRALAQSDSTCVVYGMPKAIVDENLADEIVDLDDMADAIIANLYK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagttctcgtcgtggatgattccgccttcatgcgaaaggccatcagcacgatg
cttggcaaagatccgggaatcaaggtggtgggaaccgcgcgcgacgggctggaaggcctg
gagatggtgcgcaagctcaaccccgatgtcgtgaccatggacatcgagatgcccaggatg
gacggcctgaccgccctgcggcacatcatgatggaggcgcccaggcccgtgctcatggtc
agctcgctgaccaccgagggggccgaggccaccctcaaggccatggagctgggcgcggtc
gatttcatccccaagcagctttccaaggtctcgctcgacatcgtcaagatcgagaaggac
ctcatcgcccgtgtcaagaccgtggcggcgcgcaagatgcgccatgtgccgagccgcgcg
gcagccccgcgtccggctgcgccccaggcgcccagggtggctgtcactcccggcggcagg
ccgctgcgcgacgtggtggccatcggcgtgtccaccggcgggccgcccgtggtccagaaa
atcctctcctcgctcccggctgattttccggccagcatcgtcattgcgcagcacatgccc
gccgcgtttaccgggccttttgccaagcggcttgacagcgtcagcaaaatcacggtcaag
gaagcggagaacggcgacgtgctccggcccggattcgcctacgtggcccctgggggcagg
cacatcatcctcgaccagcgcgtcagccgggtggacgtggtggtcaccgacgagcctgcc
gatgctctgtacaagccatcggccaacgtgctgatcagctccgtggcccaggcagtgggc
aagcgcgggctgggcgtcatcctgaccggcatgggcagcgacggctgcgagggcgtgcgc
gagctcaaggagcggggcgggcgcgccctggcccagagcgattccacctgcgtggtctac
ggcatgcccaaggccattgtggacgagaacctggcggacgagatcgtcgatctcgacgac
atggccgatgccatcatcgccaatctgtacaagtga

DBGET integrated database retrieval system