KEGG   Pseudodesulfovibrio aespoeensis: Daes_1921Help
Entry
Daes_1921         CDS       T01382                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00010  Glycolysis / Gluconeogenesis
das00260  Glycine, serine and threonine metabolism
das00680  Methane metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
das01120  Microbial metabolism in diverse environments
das01130  Biosynthesis of antibiotics
das01200  Carbon metabolism
das01230  Biosynthesis of amino acids
Module
das_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
das_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_1921
  Energy metabolism
   00680 Methane metabolism
    Daes_1921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_1921
Enzymes [BR:das01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Daes_1921
Membrane trafficking [BR:das04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Daes_1921
Exosome [BR:das04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Daes_1921
  Exosomal proteins of melanoma cells
   Daes_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU62930
JGI: Daes_1921
UniProt: E6VQV0
Position
complement(2125868..2126614)
Genome map
AA seq 248 aa AA seqDB search
MHKLVLVRHGQSEWNLENRFTGWTDVDLTAQGVREAVDGAALLRDGGFAFDIAHTSYLKR
AIRTLWLIQEEMDLMWLPVFKTWRLNERHYGALQGLNKAETAARYGDEQVFAWRRSFDTP
PPPLEPDDARYPGHDPRYAALSPGEVPRCESLKATIDRTMPYWFETVAPQIHAGQRVLIV
AHGNSLRGLVKYLDDMDEEAITQLNIPTGLPLVYELDDSLKALNRYYLGDQEAAARAAEA
VANQAKGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctggtactggtgcggcacgggcagagtgagtggaacctcgaaaaccgtttc
accggctggaccgacgtggacctgacggcccagggcgtccgcgaggcggtggacggcgcg
gccctcctgcgcgacggcggatttgcctttgacatcgcccatacttcttatctcaagcgg
gccatccgcaccctgtggctgatccaggaggagatggacctcatgtggctgccggtcttc
aagacatggcggctcaacgaacgccactacggcgcgctccaggggctgaacaaggcagag
accgcggcccgctacggcgacgagcaggtctttgcctggcgacgcagttttgacacgccc
ccgccgccgctcgaaccggacgatgcccgctatccgggccacgatccccgctatgccgcc
ctttcgccgggggaggtgccgcgctgcgagagccttaaggccaccatcgacaggaccatg
ccctactggttcgagaccgtggccccgcaaatccatgcgggccagcgcgtgctcatcgtg
gcccacggcaactccctgcgaggactggtcaaatacctcgacgacatggacgaggaggcc
atcacccagctgaacatccccaccggcctgcccctggtctacgagctggacgacagcctg
aaagccctgaaccggtattacctgggcgaccaggaggctgcggccagggctgccgaggcg
gttgccaatcaggccaagggcgggtag

DBGET integrated database retrieval system