KEGG   Desulfovibrio aespoeensis: Daes_1921Help
Entry
Daes_1921         CDS       T01382                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daes_1921
   01230 Biosynthesis of amino acids
    Daes_1921
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_1921
  Energy metabolism
   00680 Methane metabolism
    Daes_1921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_1921
Enzymes [BR:das01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Daes_1921
Exosome [BR:das04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Daes_1921
  Exosomal proteins of melanoma cells
   Daes_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2125868..2126614)
Genome map
AA seq 248 aa AA seqDB search
MHKLVLVRHGQSEWNLENRFTGWTDVDLTAQGVREAVDGAALLRDGGFAFDIAHTSYLKR
AIRTLWLIQEEMDLMWLPVFKTWRLNERHYGALQGLNKAETAARYGDEQVFAWRRSFDTP
PPPLEPDDARYPGHDPRYAALSPGEVPRCESLKATIDRTMPYWFETVAPQIHAGQRVLIV
AHGNSLRGLVKYLDDMDEEAITQLNIPTGLPLVYELDDSLKALNRYYLGDQEAAARAAEA
VANQAKGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctggtactggtgcggcacgggcagagtgagtggaacctcgaaaaccgtttc
accggctggaccgacgtggacctgacggcccagggcgtccgcgaggcggtggacggcgcg
gccctcctgcgcgacggcggatttgcctttgacatcgcccatacttcttatctcaagcgg
gccatccgcaccctgtggctgatccaggaggagatggacctcatgtggctgccggtcttc
aagacatggcggctcaacgaacgccactacggcgcgctccaggggctgaacaaggcagag
accgcggcccgctacggcgacgagcaggtctttgcctggcgacgcagttttgacacgccc
ccgccgccgctcgaaccggacgatgcccgctatccgggccacgatccccgctatgccgcc
ctttcgccgggggaggtgccgcgctgcgagagccttaaggccaccatcgacaggaccatg
ccctactggttcgagaccgtggccccgcaaatccatgcgggccagcgcgtgctcatcgtg
gcccacggcaactccctgcgaggactggtcaaatacctcgacgacatggacgaggaggcc
atcacccagctgaacatccccaccggcctgcccctggtctacgagctggacgacagcctg
aaagccctgaaccggtattacctgggcgaccaggaggctgcggccagggctgccgaggcg
gttgccaatcaggccaagggcgggtag

DBGET integrated database retrieval system