KEGG   Desulfovibrio aespoeensis: Daes_1936Help
Entry
Daes_1936         CDS       T01382                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
das  Desulfovibrio aespoeensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Daes_1936
Enzymes [BR:das01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Daes_1936
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Daes_1936
Lipid biosynthesis proteins [BR:das01004]
 Fatty acid synthase
  Component type
   Daes_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2139477..2140040
Genome map
AA seq 187 aa AA seqDB search
MTSPVRIACFGDSLTEGYGLRPGQALPAVLERLLDEEGMRTRCLNFGVSGDTASDGLRRI
DTVLKAVPDAAVVAFGANDCFQGDPVPLVRATLGRIIKTLLDRSIPVLLVGITAALNPDA
EYRRAFYPIFTSLAAEHGLDLFPDILVSYSGNPALTLPDGLHPSASGVEAIARDLLPQVR
QLALSAR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccggttcgcatagcctgctttggcgacagcctgaccgaagggtacggcctg
cgccccggccaggccctcccggcggtgcttgaacggctgctcgacgaagaggggatgcgc
acccggtgcctgaacttcggcgtgtcaggcgacaccgcctccgacggcctcaggcgcatc
gacacggtgctcaaggccgtgcctgacgctgctgtggtggccttcggcgccaacgactgc
tttcagggcgacccggtccccctggtgcgggcgaccctgggccggatcatcaagaccctg
cttgaccgctccatcccggtcctgctggtgggcatcaccgccgcgctcaatcccgacgca
gagtacagacgcgccttttaccccatattcacatccctggccgcagaacacgggctggac
ctgttcccggacatccttgtcagctactccggcaacccggccctgaccctgccggacggg
ctgcacccctcggcctccggggtggaagccattgcccgcgacctgctgccccaggtcagg
cagctcgctctttccgcccgctaa

DBGET integrated database retrieval system