KEGG   Pseudodesulfovibrio aespoeensis: Daes_2313Help
Entry
Daes_2313         CDS       T01382                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00230  Purine metabolism
das01100  Metabolic pathways
Module
das_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Daes_2313
Enzymes [BR:das01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Daes_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 ABC_tran AAA_18 AAA_16 RsgA_GTPase AAA_33 Thymidylate_kin Rad17 IstB_IS21 AAA_30 MobB
Motif
Other DBs
NCBI-ProteinID: ADU63318
JGI: Daes_2313
UniProt: E6VTN1
Position
complement(2516015..2516656)
Genome map
AA seq 213 aa AA seqDB search
MGSDHHNIRLGQILVVCAPSGTGKSTLIEMLRREYPDFGFSVSYTTRAPRGQEQDGREYH
FVTRDVFMEMRERGEFCEWAEVHGNFYGTATAPVEAMLDQGRDVLFDIDVQGAKQLRKTF
YKGTFVFLLPPSRAELVRRLTRRGTDSGESIARRLTNATGEMRQADFFDYWVVNDDLDTA
YEELRAVYLAGRCKPVLRPGMLDSILDTWGSDG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagtgaccatcacaacatccgcctggggcagatcctggtggtctgcgcgccgagc
ggcacgggcaagagcacgctcatcgagatgctcaggcgggagtatccagacttcggtttt
tccgtctcctacaccacccgcgcccccagggggcaggagcaggacgggcgggaataccat
ttcgtcacccgtgacgtttttatggaaatgcgggagcggggcgagttttgcgaatgggcc
gaggtccatggcaacttctacggcacggccaccgcgccggtggaggcgatgctggaccag
ggccgcgacgtgcttttcgacatcgacgtgcagggggccaagcagctgcgcaagaccttc
tacaagggcactttcgtcttcctgctgccgccctcgcgcgccgagctggtgcgcaggctg
acccggcgcggcaccgattccggggaatccatcgcccgcagattgaccaatgcgacgggc
gagatgcggcaggccgacttcttcgactactgggtggtcaacgacgacctggacacggcc
tatgaggaactgcgggccgtgtatctggccgggcggtgcaagcccgtgctgcggcccggc
atgctcgactccatcctcgacacctgggggagcgatggctga

DBGET integrated database retrieval system