KEGG   Desulfovibrio aespoeensis: Daes_2605Help
Entry
Daes_2605         CDS       T01382                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
das  Desulfovibrio aespoeensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:das01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:das00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2812495..2814255
Genome map
AA seq 586 aa AA seqDB search
MRSPISGWTGKILHIDLGTGEMAVQRPSRRLYETCLGGRGLAGHFLRPVCSLEINDPDLP
LLVFAGPLTGTIAPASGRGTIMSRSPLTGAICDSSVGGRLATQLKRAGWDGLVITGRAET
VCGIEIRDDAVRVTPTDLAGTTTDETFDRLAQAGPRGMAMAAIGPAAENGSPLACVMADR
HHAAGRGGLGLVWAAKNLKFITVKGTGKVNVHDKDGLRQAREDILRLTAASPVLLGKHGF
SCWGTGALFDLMDARRMMPTNNFAQTRFAQAGRLNAAAYKAAYGPRRHGCTGCHILCKKI
ADDGRAMPEFETMSHFTALIGNTDMDLVMQANTLCNRLGLDTISAGATLACFREIMGENF
TGRTLIKALYDMADGSYLGQGSLDFAQSCQRPELSMSVKGMELAAYDPRGAYGMALAYAL
STRGGCHLRAYPVSHEILRKPVATDRFTFSGKARIIKLAEDANAAVDSLGVCKFVFLAAG
LEEYAKAYTAVTGVAVSGPDLMAAGERICYNERIMNAHNGFDACDDDLPPRFFTEEGSSG
SGIDIPPIERAAFLEARANYYRIRGLDADGNPTRDTAIRLGLEPDR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctcccatttccggctggaccggcaagatcctccacatcgacctcggcacgggc
gagatggctgtccagcgcccgtcgcggcggctctacgaaacctgcctcggcggtcgcggg
ctggccggtcatttcctgcgcccggtctgctcccttgagatcaatgacccggacctgccc
ctgctcgtctttgccggaccgctgacaggcaccatcgctcccgcctcgggccgggggacc
atcatgtcccgctcgcccctgaccggggccatctgcgactcgtccgtgggcggcaggctg
gccacccaactcaagcgcgcgggctgggacggactggtcatcacgggccgggccgaaacg
gtctgcggtatcgaaatcagggacgacgcggtgcgcgttacgcccaccgacctggccggg
acgaccacggacgagacctttgaccgtctggcccaggccgggccaaggggcatggccatg
gccgccatcggcccggcagccgagaacggctcgcccctggcctgcgtcatggccgaccgc
caccacgctgccgggcgcggcgggctgggccttgtctgggccgcgaagaatctcaagttc
atcaccgtcaaaggcacaggcaaggtcaacgtccacgacaaggacggactcaggcaggcg
cgcgaggacatcctgcggctcacggcggcctcgcccgtgctgctcggcaaacacggcttt
tcctgctggggcaccggggccctcttcgacctcatggacgcgcggcgcatgatgcccaca
aacaacttcgcccaaacgaggttcgcgcaggcgggccgactcaacgccgcggcctacaag
gcggcttacgggccgcgcaggcacggctgcaccggctgccacatcctgtgcaagaagatc
gcggacgacgggcgcgccatgcccgaattcgaaaccatgtcccacttcaccgcgctcatc
ggcaacacggacatggatctggtcatgcaggccaacaccttgtgcaaccggctcgggctg
gacaccatctctgccggggccaccctggcctgcttccgcgagatcatgggcgaaaacttc
accgggcgcaccctgatcaaggccctctacgacatggccgatggcagctacctgggccag
gggtcgctcgatttcgcccagtcgtgccagcggcccgagctgtccatgtcggtcaagggc
atggagctggccgcctacgacccgcgcggagcctacggcatggccctggcctacgccctg
agcacccgcggcggctgccatctgcgcgcctacccggtcagccacgagatcctgcgcaag
cccgtggccacggaccggttcaccttcagcggcaaggcccgcatcatcaagctggccgag
gatgccaacgccgccgtggattcccttggcgtgtgcaagttcgtcttcctggccgccggg
ctggaggaatacgccaaggcctacaccgcagtcaccggcgtggcggtcagtgggccggac
ctcatggccgcaggcgagcgcatctgttacaatgaacggatcatgaacgcgcacaacgga
ttcgacgcctgcgacgacgacctgcccccgcgcttttttaccgaggaaggctcgtcgggc
agcggcatcgacatcccccccatcgagcgcgccgcgttcctcgaagcccgcgccaactac
tatcgcatccgggggctcgacgcggacggcaaccccacccgcgacacagccatccgcctg
gggctggagcctgaccgatga

DBGET integrated database retrieval system