KEGG   Desulfovibrio aespoeensis: Daes_2616Help
Entry
Daes_2616         CDS       T01382                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
das  Desulfovibrio aespoeensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:das00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daes_2616
Enzymes [BR:das01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Daes_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2823233..2823844
Genome map
AA seq 203 aa AA seqDB search
MIGYLQGTLLAAHDKGLVLLTPGGVGYEVAAPTSVLARLPGRGGEVSLFVHTQVGEKAID
LFGFLESDDLDLFRTLISIDKLGPKKALAILSMFDAEHLREVAYREDATTLSTVPGIGPK
SAKQILWHLKDKVNKLSPAPSRGSAKVEGPRGEYLDTLAGLKGLGYSEDEVRPMILEIFD
AEPDLDAAGAIRATLRKIAAARS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatatcttcagggaacgctgctcgccgcccatgacaaggggctggtgctgctc
acccccggcggcgtgggctacgaggtggccgcgcccacgtcggtcctggcccggctgccc
ggcaggggcggcgaggtgtcgctcttcgtccacacccaggtgggcgaaaaggccatcgat
ctcttcgggttcctggagagcgacgacctcgacctgttccgcaccctcatctccatcgac
aagctggggccgaaaaaggccctggccatcctgtccatgttcgatgccgagcacctgcgc
gaagtggcctatcgcgaggacgcgaccaccctttcgaccgtgccgggcattggccccaag
tcggccaagcagatattgtggcacctcaaggacaaggtcaacaagctctcccctgccccg
tccaggggcagcgccaaggtcgagggaccgcgcggcgaatacctcgacacccttgcgggt
ctcaaggggctggggtattccgaggatgaggtgagacccatgatactggaaatcttcgac
gccgagcccgaccttgatgccgccggagccatccgcgcaacgctcagaaagatagcggcg
gcccggtcatga

DBGET integrated database retrieval system