KEGG   Desulfovibrio aespoeensis: Daes_2674Help
Entry
Daes_2674         CDS       T01382                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
das  Desulfovibrio aespoeensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:das00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:das00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2894155..2895294
Genome map
AA seq 379 aa AA seqDB search
MRRLSPPLAPLIAPLIALFLLFSLPAAAAGTTADTSASQDLDAMIGQMLMAGFRGFTVDE
QSPIVRDIRERNLGGVVLFDYDVALASPNRNIDTPAQVARLTAALAGFATTPLLVAVDQE
GGRVQRLKPARGFTGSPSAKELGVMDDAAIKAAGAGVGATLRQAGFNLDFAPVADVDVNP
DSPAIGRLGRSFSADPARVGRCAGLFLAGLASQGVTGCLKHFPGHGSAGTDSHLGVTDVT
ATWTSDEMKPYRMLIEQGAARMIMTGHIFNARLDPDHPATLSHATITTLLRGELGFDGVI
ITDDMDMKAITERYGRDEAVRLAIEAGADILLFGNNLTYDPDVVRQTHALIKAMVRDGVI
SQTRIRQSHDRIMRLKGSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactctcgccgccccttgccccactgattgccccgctgatcgccctctttctc
ctgttctccctgcctgccgccgcagccgggacaaccgccgacacgagcgcgtcccaggac
ctcgacgccatgatcggccagatgctcatggccggattccggggcttcacggtggatgaa
caaagccccatcgtgcgcgacatccgcgagcgcaatctgggcggggttgtcctcttcgac
tatgatgtggccctggccagcccgaaccggaacatcgacaccccggcccaggtggcccgg
ctgacggcggccttggcaggatttgccaccacgcccctgctggtggccgtggaccaggag
ggcgggcgggtgcagcgtctcaagcccgcgcgcgggttcacggggtcgccctcggccaag
gaattgggcgtcatggacgacgcagccatcaaggccgccggggccggggtgggcgcgacc
ctgcgccaggcgggcttcaatctcgatttcgcgcccgtggccgatgtggacgtcaacccg
gacagcccggccatcggcaggcttggccgcagcttttccgctgatccggcccgggttggc
cgctgcgccggactgttcctggccgggctggccagccagggcgtgactgggtgcctcaag
catttccccggccatggcagcgcgggcacggacagccacctgggcgtcaccgacgtgacc
gccacctggacctccgacgaaatgaagccttaccgcatgcttatcgaacagggcgcggcc
cggatgatcatgaccgggcacatcttcaacgcccggctcgatccggaccatccggccacc
ctgtcccacgccaccatcaccaccctgctccggggcgagctgggctttgacggcgtcata
atcaccgatgacatggacatgaaggcgatcaccgagcggtacggtcgcgacgaggcggtc
aggctggccatcgaggccggggcggacatcctgctcttcggcaacaacctgacctatgac
ccggatgtggtgcgccagacgcacgcgctcatcaaggccatggtccgggacggcgtcatc
agccagacgcgcatccgccagtcccatgaccggatcatgcggctcaaggggtcgcgttaa

DBGET integrated database retrieval system