KEGG   Desulfovibrio aespoeensis: Daes_2676Help
Entry
Daes_2676         CDS       T01382                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daes_2676
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_2676
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daes_2676
Enzymes [BR:das01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daes_2676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2895936..2897279)
Genome map
AA seq 447 aa AA seqDB search
MPKRIFLSQDQMPTQWYNPMPDLPTPLAPPLNPETMEPITPDMLAPIFPDSLIAQEMSGE
RFIDIPEAVQDVYRLWRPSPLVRADRLEKAIGAKCRIYYKDESVSPAGSHKPNTSVPQAY
YNKMAGVERLATETGAGQWGTALSFACAQFGLECVVYMVKVSFEQKPYRKMLINSYGGTI
FASPSEQTRTGREMLARDPGCKGSLGLAISEAVEDAATHDNTKYALGSVLNHVIIHQTIT
GLEVQKQLAMIGEKATHLVGCVGGGSNFGGLVMPFLPQKLAGDPVRFIPVEPKACPTLTR
GEYRYDYGDMARLTPLVKMHTLGHDFMPAPIHAGGLRYHGDAPIVCNVVAEGLCEPVAYY
QTECFEAARLFLQTEGFLPAPETSHAIKGAIEVAKTAGPDDVIVFLYSGHGLLDLASYDA
FNQGLLTNFELPQRDIEEALKRCPVIK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagagaatctttttgtcccaggaccagatgcccacccagtggtacaatcccatg
ccggatctgcccacgcccctggctccgccgctcaatccggagaccatggaacccatcacc
ccggacatgctggcccccatatttcccgactcgctcatcgcccaggagatgagcggcgag
cggttcatcgacattcccgaagcagtgcaggatgtctaccggctgtggcggccctcgccc
ctggtgcgggcggaccggctggaaaaggccatcggcgcgaaatgccgcatctactacaag
gacgagtccgtctccccggcagggtcgcacaagcccaacacctcggtgccccaggcctac
tacaacaagatggcgggcgtggagcggctggccaccgagaccggcgcgggccagtggggc
acggccctgtcatttgcctgcgcccagttcggcctggaatgcgtggtctacatggtcaag
gtcagctttgagcagaaaccctaccgcaagatgctcatcaactcctacggcgggaccatc
ttcgcctcgccgtccgagcagacccgcacggggcgcgagatgctggcccgcgaccccggc
tgcaagggctcgctgggcctggccatctccgaggcggtggaggacgcggccacccacgac
aacaccaagtacgcgctcggctcggtcctcaaccatgtcatcatccaccagaccatcacc
ggccttgaggtgcagaaacagcttgccatgatcggcgagaaggccacccacctcgtcggt
tgcgtgggcggcgggtccaacttcggcgggctggtgatgccgtttttgccccagaagctg
gcgggcgacccggtccgcttcatcccggtggagccaaaggcttgcccgaccctgaccagg
ggcgaataccgctacgattacggtgacatggcccggctcaccccgctggtcaagatgcac
accctggggcatgacttcatgcccgcgcccatccacgcgggcggcctgcgctaccacggc
gacgcgcccattgtctgcaatgtggtggctgaggggttgtgcgagcccgtggcctactac
cagaccgagtgtttcgaggcggcccggctcttcctccagaccgagggattcctgcctgcg
cccgagacctcgcacgccatcaagggagccattgaggtggccaaaaccgccgggccggac
gatgtgatcgtgttcctctattcgggtcacggcctgctcgatctcgcctcctacgacgcc
ttcaaccaggggctgctgaccaacttcgaactgccccagcgcgacattgaggaagccctc
aagcgctgcccggtgatcaagtag

DBGET integrated database retrieval system