KEGG   Desulfovibrio aespoeensis: Daes_2709Help
Entry
Daes_2709         CDS       T01382                                 

Definition
alpha-glucan phosphorylase (EC:2.4.1.11 2.4.1.1)
Orthology
K16153  
phosphorylase / glycogen(starch) synthase [EC:2.4.1.1 2.4.1.11]
Organism
das  Desulfovibrio aespoeensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Daes_2709
Enzymes [BR:das01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Daes_2709
    2.4.1.11  glycogen(starch) synthase
     Daes_2709
Glycosyltransferases [BR:das01003]
 Polysaccharide
  Storage polysaccharide
   Daes_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2935147..2939385
Genome map
AA seq 1412 aa AA seqDB search
MESSWLFEVSWEVCNKVGGIHTVISSKAAEAMAAFDGRYVAIGPLLDRNPGFDPCDPPEE
FAATLERLKQHNIPTSVGQWDIPGRPWVLLVDFQGAFPTHDKLLFQLWNDFGVDSMTGGW
DYIEPLVFSTTAAMVIKEIHDDVEGVSEVFAHFHEWMSGAGVLYLKKQAPAVATLLTTHA
TMLGRAMSGSGVDIYERLEEIEPSQEAKAYGVAAKHSMESVAAREADCFATVSDITRREA
SNLLGTNPAVVTFNGFNLEGFAEPVAVEKTRKTARNRLIDLASRFLERDLKPDKTLLVAT
SGRYEFHNKGIDLLIESLAQVDGELAKADSDMTVVTFLLVTCGYAGFSEEARKRLKDEHY
SIEKYGGIATHHLGDSDRDSIVLKCREMKLNNEPANRCCVIFIPVYLDGNDGILNLEYYD
ALAGMDLTVFPSFYEPWGYTPMESAAFYVPTITADRAGFGQWVMERHPGGHPGVMVLNRL
RDNFRTAAGKLAKTLLDFTRWSPEERAFRRGEARRIAEEATWKNFYPLYIEAYELAAGIR
TERVAGVQRMAMAPGKLFSFTGVNTTQPRLKSFSVITDLPDNLARLRDLASNLWWVWHRD
AQEIFEGIDAQRWQQCGHNPVEFLNALDPERIAHVADDAAFMGRVKEVLARFDAYMAESG
KADHGGITWSNPISYFSMEFGLHESIPIYSGGLGLLAGDHIKSASDLNLPFIGVSLLYKN
GYFHQRINGNGEQVVEYHENNFASMPIIPLQNGDSDRVLVTVDLPGRPIYAQVWEVRVGR
AKLYLLDTDVPENSRTDRDIAAKLYEPSSKGRIEQEILLGVGGVRMFKTLGITPCLYHLN
EGHSAFLLFERIRQLMRLEGVDFATAKEIVRGSTCFTMHTPVPAGNERFERSLVENYFRG
YAAEMDVPWDALWNLGHMYAEEADHLNMTVLALQLSYVRNGVSKLHGEVSRRMWMDLWRG
FLFSEVPVGHITNGVHITTWLDERLRRDIEETCNISVHSALSDDIDWAGLDDIDDRRLWD
THIALKHRLYDEIRRSISNQWAREGEPPNRLRTFLDTLNPDHLTLCFARRFTAYKRPTLL
FHNLNKVKELFRNPEKPINIIFAGKAHPADTIGSSFINLICRLAKQDDFLGRVIFLESYD
IRLARLLVSGSDVWLNNPTRLMEASGTSGMKAALNGVPNCSILDGWWDEAFDTKNGWAVG
QGLVYETQVNQDIVDADNLYAVLETEVVPEFYDRGDGVPHGWIKRMKESMKTAFKQYGTH
RMVRDYISDMYLPTLALAARRNKNKYALAKDVGTWQRRIPGRFSTVNIKEIRVEGIHGDV
FMLGNTLRISAKVDKGQLLQEEMLVELIVASPGEDTVLDCKPLKLKHTEGNNLEFRVEYT
PASSGTCRYGIRVIPVHPGLGTKYETRLIRWS
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atggaatccagttggctgttcgaagtatcgtgggaagtatgcaacaaggtgggcggcatc
cataccgtcatcagcagcaaggcagccgaagccatggccgcctttgatggccgctacgtg
gccatcggccccctgctcgaccgcaatccggggttcgacccctgcgacccgcccgaggaa
ttcgccgccactctggagcggctcaagcagcacaacatccccaccagcgtgggccagtgg
gacatccccggcaggccgtgggttctgctcgtcgatttccagggggccttcccgacccac
gacaagctccttttccaactgtggaacgactttggcgtggactccatgaccggcggctgg
gactacatcgagccgctggtcttcagcaccaccgcggccatggtcatcaaggagattcat
gacgacgtggagggcgtgtccgaggtctttgcccatttccacgaatggatgtccggcgcg
ggcgtactctacctcaagaaacaggcgcccgccgtggccaccctgctgaccacccacgcc
accatgcttggccgggccatgtccggctccggggtggacatctacgagcggctggaggag
atcgagccgtcccaggaggccaaggcatacggggtggcggccaagcactccatggagtcc
gtggccgcgcgcgaggcagactgctttgccaccgtgtcagacatcacccggcgcgaggcg
tccaacctgctgggcaccaacccggctgtggtcaccttcaacggcttcaacctcgaaggc
tttgccgagcctgtggcagtggaaaaaacgcgcaagaccgcccgcaaccggctcatcgac
ctcgcctcccgctttctggagcgcgacctgaagccggacaagaccctgctggtggccacc
agcggcagatacgagttccacaacaagggcatcgacctgctcatcgagagcctggcccaa
gtggacggagagctggccaaggcagactcggacatgaccgtggtcaccttcctgctggtc
acctgcggctacgcgggcttcagcgaggaggcgcgcaagcggctcaaggacgagcactac
agcatcgagaaatacggcggcatcgccacccaccatctcggcgactcggaccgcgactcc
atcgtgctcaaatgccgcgagatgaagctgaacaatgagcctgccaaccgctgctgcgtc
atcttcattccggtctacctcgacggcaacgacggcatcctcaacctggaatactacgac
gccctggcgggcatggacctgaccgttttcccctccttctacgagccgtggggctacacc
cccatggagagcgcggccttttacgtgcccaccatcacggcggaccgggccggtttcggc
cagtgggtcatggagcggcaccctggcgggcaccccggcgtcatggtcctcaaccggctc
cgggacaacttccgcaccgccgcaggcaagctggccaagaccctgctcgacttcacccgc
tggtcgcccgaggagcgcgcctttcgccgcggcgaggcccggcgcatcgccgaagaggcc
acctggaagaacttctatcccctctacatcgaggcctatgaactggccgcgggcatccgc
accgagcgggtggcgggcgtgcaacgcatggccatggccccgggcaaactgttcagcttc
accggcgtcaacaccacccagcccaggctcaagtccttctcggtcatcaccgacctgccg
gacaacctggccagattgcgcgacctggcctccaacctctggtgggtctggcaccgcgac
gcccaggagatattcgagggcatcgacgcccagcggtggcagcaatgcggccacaacccg
gtggaattcctgaacgcactggacccggagcgcattgcccatgtggcggacgacgcggcc
ttcatgggccgcgtcaaggaggtactcgcccgcttcgacgcctacatggccgagagcggc
aaggcggatcacggaggcattacctggagcaaccccatctcctacttctccatggaattc
ggcctgcacgagtccatccccatctactccggcggcctgggcctcctggctggcgaccac
atcaagtcggccagcgacctcaacctgccctttatcggcgtctcgctgctctacaagaac
ggctactttcaccagcgcatcaacggcaacggcgagcaggtggtcgagtaccacgagaac
aacttcgcctccatgcccatcatcccgctgcaaaacggcgactcggaccgcgtcctggtg
accgtggacctgccgggccgccccatttacgcccaggtctgggaggtgcgcgtgggccgg
gccaagctctatctgctcgacaccgacgtgcccgagaactcccgcaccgaccgcgacatc
gcggccaagctctacgaaccgtcgtccaagggacgcatcgagcaggagatcctgctcggc
gtgggcggcgtgcgcatgttcaagaccctgggcatcaccccctgcctctaccacctcaac
gagggccactcggccttcctgctcttcgagcgcatccggcagctcatgcgccttgagggc
gttgatttcgcaacggccaaggagatcgtgcgcgggtccacctgcttcaccatgcacacc
ccggtcccggcgggcaacgagcggttcgagcgctccctggtggagaactacttccgcggc
tacgccgccgagatggacgtgccctgggacgccctgtggaacctcggccacatgtacgcc
gaggaggcggaccacctgaacatgaccgtacttgccctccagctctcctacgtcagaaac
ggcgtcagcaagctgcacggcgaggtctcccggcgcatgtggatggacctgtggcggggc
ttcctgttcagcgaggtgccagtgggccacatcaccaacggcgtgcacatcaccacctgg
ctcgacgaacggctcaggcgcgacattgaggagacctgcaacatctcggtccactcggcc
ctttccgacgacatcgactgggccgggctggacgacatcgacgaccgccgcctgtgggac
acccacatcgccctcaagcaccggctctacgacgagatccgccgctccatctccaaccag
tgggcgcgcgaaggcgagccgccaaaccggctgcgcaccttcctcgacaccctcaacccg
gaccacctgaccctgtgcttcgcccggcggttcacggcctacaagcggcccacgctgctg
tttcacaacctgaacaaggtcaaggaactgttccgcaaccccgaaaaacccatcaacatc
atcttcgcgggcaaggcacacccggcagacaccatcggctcgagcttcatcaacctcatc
tgccggctggccaagcaggacgacttccttggccgggtcatcttccttgagagctacgac
atccggctggcccgcctgctcgtctccggctctgacgtgtggctgaacaaccccacccgg
ctgatggaggccagcggcaccagcggcatgaaggccgccctcaacggcgtgcccaactgc
agcatcctcgacggctggtgggacgaggcctttgacaccaaaaacggctgggccgtgggc
caggggctggtctatgagacccaggtcaaccaggacatcgtggacgccgacaacctctac
gccgtgctcgaaaccgaagtggtgccggagttttacgaccggggcgacggcgtgccccac
ggctggatcaaacggatgaaggaatccatgaagaccgccttcaagcagtacggcacccac
cgcatggtccgcgactacatcagcgacatgtacctgcccaccctggccctggctgcgcgg
cgcaacaagaacaagtacgccctggccaaggacgtgggcacgtggcagcggcgcatcccg
ggccgcttctccacggtcaacatcaaggagatccgggtggagggcatccacggcgacgtg
ttcatgctcggcaacaccctgcggatatcggccaaggtggacaaggggcaattgctccag
gaggagatgctggtggaactgatcgtggccagcccaggcgaggatacggtcctcgactgc
aagccgctcaagctcaagcacaccgagggcaacaacctggagttccgggtcgagtacacc
ccggcctcgtccggcacctgccgctacggcatccgggtcatcccggtccatccgggcctt
ggcaccaagtacgagacccgcctgatccgatggagctga

DBGET integrated database retrieval system