KEGG   Desulfovibrio aespoeensis: Daes_3196Help
Entry
Daes_3196         CDS       T01382                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
das  Desulfovibrio aespoeensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Daes_3196
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Daes_3196
Enzymes [BR:das01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Daes_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3456645..3457574)
Genome map
AA seq 309 aa AA seqDB search
MKWLHKDLLDVSQLSRPEVMAIFETAGRFQELQERPVKKVPTLKGRSVILFFAEPSTRTK
TSFDVAGKRLSADTFSLTKSSSSLIKGETLKDTALTLQAMAPDAIVMRHWCSGAARFLSR
RVECSVINAGDGRHAHPTQALLDSFTLHQEWGEVAGKTILILGDIAHSRVARSNVLLLTM
LGARVRLCAPRTLLPPAARSWPVTVYSDLNEAVRGVDAVMCLRLQLERQQDGLLPDLREY
ARTYGLGPRHVELARPEVKILHPGPINRGVEINSELADCADSLILDQVSSGVVVRMALLF
LYMTRKGEM
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctacacaaggatctgctggacgtgtcccagctgtcgcggcccgaggtcatg
gcaatcttcgagaccgcagggcggtttcaggaattgcaggagcggcccgtcaagaaggtg
cccaccctcaaggggcgtagcgtgatcctgttctttgccgagccgagcacgcgcaccaag
acgagttttgatgtggcgggcaagcggctctcggcagacaccttctccctgaccaagagc
tcgtccagcctgatcaagggcgagaccctcaaggacacggccctgacgctccaggccatg
gccccggacgccatcgtcatgcgccattggtgcagcggcgcggccaggttcctgtcccgg
cgggtggagtgttcggtcatcaacgcgggcgacgggcggcacgcccaccccacccaggcg
ctgctcgacagcttcaccctgcaccaggaatggggcgaggtggcgggcaagacgatcctc
atcctcggcgacatcgcccacagccgtgtggcccggtccaacgtcctcctgctcaccatg
ctgggggccagggtgcgcctgtgcgccccgcgcaccctgctgccgccggcggcccgctcc
tggccggtgacggtgtattcggacctgaacgaggcggtgcgcggcgtggacgcggtcatg
tgcctgcgcctgcaactggagcgccagcaggacggcctgctgcccgacctgcgcgagtac
gcgcgcacctacggccttggcccgcgccatgtggagctggcccggcccgaggtcaagata
ttgcacccaggccccatcaaccggggggtagagatcaattccgagctggccgactgcgcc
gactccctgatcctcgatcaggtctcaagcggcgtggtggtgcgcatggccctgctcttt
ctctacatgacccgcaagggcgaaatgtag

DBGET integrated database retrieval system