KEGG   Desulfovibrio aespoeensis: Daes_3267Help
Entry
Daes_3267         CDS       T01382                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
das  Desulfovibrio aespoeensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daes_3267
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Daes_3267
Enzymes [BR:das01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Daes_3267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3540568..3542325
Genome map
AA seq 585 aa AA seqDB search
MIRDHFRIMKVDLTTGKANLIERDGRDQYLGGTGLAAMLFDEFGHMDRDWDDPDQPLIFT
IGPLTGYYPLMSKTCCAFRSPYHNQYAESYAGGKSALSLRFADLDALVVVGKAKRLSALA
VGSRLIEIRDVEYMRGFDALRTGRVIRKIFPGSGRRSILRIGPAGENLSAYACINVDTYR
HFGRLGGGTVMGAKNLKAICILGDRGFDLPEGKAYSTLYKDIFKQLTTTEMMAKYHGLGT
AVNINPLNALKSLPWKNLQQTSSPEADNISGERFAKDTLLRNAACAGCPVGCIHVGFVRE
QFQANNQYLYRQVSYDYEPIFSCGGMLEVTDAGQVLRILDVIEKEGLDNMSTGVALAWAT
EALEKGVISLDETVVPLTWGDAETYMKGVELISRPPNDFYRLLAQGSLKCAKKYGGEDFA
CVLGQEMAGYATGEVFFVSEALGFRHSHLDSGGYAYDQKHEDKDVTRALDFLVNDARERV
VLNCMVGCLFSRGVYKDSVLAQALEAVGYGSLVGSLDAIGRRVQSLRWRLRLGMGYEPAR
VVIPKRYTEVTTWKGPIDTDYLEALRTGYAARIMEMGAPLPESEE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgattagagaccacttccgcatcatgaaggtcgatctgaccacgggcaaggccaacctc
atcgaacgggacggacgcgaccagtacctgggcggcaccgggctggcggccatgctcttt
gatgaattcggccatatggacagggactgggacgacccggaccagccgctgatcttcacc
atcggtccgctgaccggctattacccgctcatgagcaagacctgctgcgccttccgctcg
ccctatcacaaccagtacgccgagagctacgcgggcggcaaatccgccctgtcgctccgg
ttcgcggacctcgacgcattggtcgtggtcggcaaggccaagcggctgtctgccctggcc
gttggctcgcgtctgatcgagatccgcgacgtggaatacatgcgcggctttgacgccctg
cgcacgggccgcgtcatccgcaagatattccccggttcgggccgccgctccatcctgcgc
atcggcccggcgggcgagaacctctcggcctacgcctgcatcaacgtggacacctaccgc
cactttggccgcctgggcggcggcacggtcatgggagccaagaatctcaaggccatctgc
atcctgggcgaccggggctttgacctgcccgagggcaaggcctactccaccctgtacaag
gacatcttcaagcagctcaccaccacggagatgatggccaaataccacggcctgggcacg
gcggtgaacatcaacccgctcaacgcgctcaaaagcctgccctggaagaacctgcaacaa
accagcagccccgaggcggacaacatctcgggcgagcggtttgccaaggacaccctgctg
cgcaacgcggcctgcgcaggctgcccggtgggctgcatccacgtgggcttcgtgcgcgag
cagttccaggccaacaaccagtatctctaccggcaggtgagctacgactacgagcccatc
ttctcctgcggcggcatgcttgaggtcacggacgcaggccaggtcctgcgcatcctcgat
gtcatcgaaaaggaagggctggacaacatgtccacgggcgtggccctggcctgggccacc
gaggcgctggaaaagggcgtcatcagcctggacgagaccgtggtccccctgacctggggc
gatgccgagacctacatgaagggcgtggagctgatcagccgcccgccaaacgacttctac
cggttgctggcccagggctccctcaagtgcgccaaaaaatacggcggcgaggattttgcc
tgcgtcctcggccaggagatggccggatacgccacgggcgaggtcttcttcgtgtccgag
gcgctcggcttccgccactcccacctcgactcgggaggctacgcctacgatcagaaacat
gaggacaaggacgtgaccagggcgctcgatttcctggtcaacgacgcccgcgagcgggtc
gtgctcaactgcatggtgggctgcttgttctcacgcggggtgtacaaggactcggtgctg
gcccaggccctggaggccgtgggctacggctccctcgtcggctcgctcgacgccataggc
cgccgggtgcagagcctgcgctggcggctgcgcctgggcatgggctacgaaccggccagg
gtggtcatacccaaacgctacaccgaggtgaccacctggaaagggcccatcgacaccgac
tacctggaggccctgcgcacgggctacgccgcccggatcatggaaatgggcgctccgctg
cccgagtccgaagaatga

DBGET integrated database retrieval system