KEGG   Desulfobacterium autotrophicum: HRM2_02030Help
Entry
HRM2_02030        CDS       T00861                                 

Gene name
adh3
Definition
hypothetical protein (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HRM2_02030 (adh3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_02030 (adh3)
  Lipid metabolism
   00071 Fatty acid degradation
    HRM2_02030 (adh3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HRM2_02030 (adh3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HRM2_02030 (adh3)
   00626 Naphthalene degradation
    HRM2_02030 (adh3)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HRM2_02030 (adh3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245055..246341)
Genome map
AA seq 428 aa AA seqDB search
MPMPDNPSNKEAAMYLPDYYEFCCRVKTVAGHQALETIPDLLSDMGAQKPMIVTDQGVSG
AGLVDTVMTAMAGKVTPGPVADDVPPDSDLRMVNGLASVYRENGCDAIIAVGGGSVLDTA
KAVNILVSEGSDDLMAFTGANALKRKLKPLIAIPTTAGTGSEVTIVAVIADPDKRRKMLF
TSPFLLPDAAVIDSRMTLTLPPHITAPTGMDALSHAVEAYTCLAKNPLSDAHALEAIELI
STHLVNTVKNPGDRDGRLALATAATLAGIAFSNSMVGMVHTLGHSVGSVCHVPHGTCMAI
LLPYGLEYNMHKVEDRIAELLFPLAGSEVYASTRPHDRATAAISLIRKLNQDLFDATNGR
HCTAFNQVKTPEGHPAVCSRDLEAIARTALGDGSIFYNPEELDFDDCMLVLSAAWDGTPL
DRSKVKQG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgccggacaacccatcaaacaaggaggcggccatgtacctgcctgattactat
gaattctgctgcagggtgaaaaccgttgccgggcaccaggccctggaaacaatacccgac
cttctttcggacatgggtgctcaaaaacccatgattgtgaccgaccagggggtgagcggc
gcaggccttgtggacacggtaatgacggccatggccggcaaagtcaccccgggtccggtg
gccgacgatgtacccccggattccgatctcaggatggtcaacggccttgcctcggtatac
cgggaaaatggctgcgatgccattatcgccgttggcggcggctcggtgcttgacacggcc
aaggccgtcaatatcctggtatccgaagggtccgacgatctcatggcctttaccggcgcc
aatgccctcaaacgaaaactcaagcccctgatcgcgattcccaccacagcaggtacaggt
tccgaggtgaccattgtggccgtgattgcagacccggacaaacgccgaaaaatgctcttt
acctcaccgtttcttcttccagatgcggccgtcattgattcaaggatgaccttgaccctt
cccccccatatcacggctcccacgggaatggatgccctgtcccatgccgtggaggcctat
acctgccttgcaaagaatcccctgagcgacgcccatgccctggaggcaattgagctgatc
tcaacccacctggtaaacaccgtcaaaaatcccggagaccgggacggccgcctggccctg
gcaacggcagccacccttgcaggcattgccttttccaactccatggtgggcatggttcac
acccttggccactcggtgggctcagtttgccacgtgccccacggcacctgcatggccatt
ttactgccctatggtctggagtacaatatgcacaaggttgaagaccgcatcgcagaactt
ctctttcccctggccgggagcgaggtatatgcatccacccgcccccatgaccgggcaacg
gcagccatctccctgatccgcaagctgaaccaggatctctttgacgccaccaatggacgc
cattgtacggcctttaaccaggtcaagacccccgagggtcaccctgccgtgtgcagccgg
gaccttgaagccattgcccggactgcccttggggacggttccattttttacaatccagaa
gagcttgattttgacgactgcatgctggtgctgtccgcagcctgggacgggacccccctg
gaccgttcaaaggtgaaacagggataa

DBGET integrated database retrieval system