KEGG   Desulfobacterium autotrophicum: HRM2_02430Help
Entry
HRM2_02430        CDS       T00861                                 

Definition
signal transduction family protein (GGDEF domain-containing protein)
Orthology
K13590  
diguanylate cyclase
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291320..292339
Genome map
AA seq 339 aa AA seqDB search
MLYNEDKNQAGEYLRLSLGFIAKYNLPADPACYSVWYQYIAGKNPHLKAVLDYIIKNEKQ
ITVNTIKKLYKDHILEKDRTITENLLQELRIVINGISRYAIDTTGDIAGNGKRLQALVRE
LEEDEDMDSLARTMDKIIQEAKALVQTGKSFQGRMASSSQELASLRKKLDVSKKDAETDA
LTGLLNRRGFESRLHPLLKDPQSCFCLIMIDIDHFKRVNDTYGHLVGDSILKALANLLKQ
QTKGKDCLARFGGEEFIILLPETRLEQAGAVAEDIRKKLAAQEWKQRKTGKPMGKITISL
GVTQYRPNESEVTLIHRVDTALYTAKRNGRNRVVTEEMV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacaatgaagataaaaatcaggccggggagtatttaaggctatcccttgggttt
attgccaaatataacctgccggcagaccctgcctgctatagtgtctggtatcagtatatt
gcagggaaaaatccccacctgaaagctgtccttgattatattatcaaaaatgagaaacag
ataaccgtcaacaccataaagaaattgtacaaagatcatattctggaaaaggatagaacc
atcacggaaaacctgctccaggagttgcggatcgttattaatgggatttcacgctatgcc
attgataccaccggagacattgccggaaatggtaaacggcttcaagcccttgtcagggaa
ctggaagaggacgaggatatggacagcctcgccaggaccatggacaagatcatccaggag
gccaaagcgcttgtgcagacgggaaagagtttccaggggcgcatggcctcatcctcccag
gaacttgcctcccttagaaaaaagctggatgtgtcaaaaaaagatgccgaaaccgatgcc
ctgacaggtctgttgaatcggcgtggttttgaaagcaggctgcatccccttctcaaggat
ccccaatcttgtttttgcctcatcatgatcgatatcgaccattttaaacgggtcaacgat
acctatggtcacctggtcggtgacagcattctcaaagccctggcaaacctgttgaagcag
cagaccaagggtaaggattgcctggctcggtttggaggtgaagagtttatcatcctgctt
cctgaaacccgacttgaacaggccggggctgttgcagaggatatccggaaaaaacttgcg
gcccaggaatggaaacagcggaaaacaggaaaacccatgggcaaaatcaccatttccctt
ggcgtaacccagtaccggcccaatgaatcggaagtcactttgatccacagggtcgataca
gccctttatacggccaaacggaacggcaggaaccgggtggtcaccgaagagatggtataa

DBGET integrated database retrieval system