KEGG   Desulfobacterium autotrophicum: HRM2_04880Help
Entry
HRM2_04880        CDS       T00861                                 

Gene name
aor2
Definition
hypothetical protein (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dat01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dat00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(556556..558697)
Genome map
AA seq 713 aa AA seqDB search
MNPFTLKEIAAISYKRADVVCGYTDKSLHINMSDSTIAINDIDAKTKQTFIGGKGYDLWL
MWNAVTGTTKWNDPENAICIASGPLGGTPGYPGGGKSIVTTISPTTGAPMDSNVGGYFGP
YKKFSGFDVIEITGKADCETIILIDGIEEKIKIFEVQGLTDDSYALSEALTNYFDPDKPV
NISVVSTGTAAKHSLLGCLNFTWFDAKRKRVRYKQAGRGGIGTVLADKKVKAVVARWGTI
SLSSNRPADKEALKKVTKLHAREIATLDPKQNRMALVGTTHLVPIMNDHDCLPVRNFRYG
FHPEGKNIGEEVYEHIFDKGFDGCWRGCTVACAHGVKDFTPFTGPYRGKKVFVDGPEYET
IAGCGSNLGIFDPFFILEVNFYCDTYGLDTISIGTGIAFVMECFEMGLINETHTGGMDLS
FGNRVNALELIHQMARGEGFGMILGQGIRRMKTIFARDFGADMAIMQDIGMESKGLEFSE
YMTKESLAQQGGYGLALKGPQHDEAWLIFLDMVHNFMPTFENKAEALHWFPMFRTWFGLC
GLCKLPWNDIVPEDNKSTKEPAKVVKHVGWYADFFTAVTGRHSTPEDLISMSEGVYNFQR
IFNLKMGYGTREHDSLPYRSMGPVTRDEYESRSERYDKDLVENHNIDISAMTVEEKMAVL
RQKREANYEKLIDAVYERRGWTQNGIPTLATVKRLGIDFPEVVALLATNGINS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaacccctttaccctgaaagagatcgcagcgatttcctataaaagagccgacgttgtc
tgtggctatacggacaaatcccttcatatcaatatgtcggacagcaccattgccatcaac
gacattgacgcaaagacaaaacagaccttcatcggcggcaagggctacgacctgtggctc
atgtggaatgccgtaacaggcactaccaaatggaacgacccggaaaatgccatctgcatc
gcctcaggcccccttggaggcacccccggatacccgggcgggggaaaaagtattgtcacc
accatctcaccgacgaccggtgcccccatggattccaacgtgggcggctactttggaccc
tacaagaagttttcaggctttgatgtcattgaaatcacgggcaaggccgattgtgaaacc
attatcctgattgacggcattgaagaaaaaattaagatctttgaagtccagggactcacc
gacgactcctatgcactgtccgaggccctgaccaactactttgatccggataaaccggtt
aacatctccgtcgtatccactggaacggcggcaaagcacagcctgctgggctgccttaac
ttcacctggtttgacgccaaacggaaacgggtgagatacaaacaggccggcaggggtggc
attggaacggtacttgccgacaaaaaagtcaaggccgtggtggcccggtggggcaccatt
tcgctgtccagcaaccgccccgcagacaaggaggccttgaaaaaggtgaccaaactccac
gcccgggagattgccacccttgatcccaagcaaaaccgcatggccctggtgggtaccacc
caccttgtacccatcatgaacgaccacgattgcctgcccgtaagaaacttcaggtacgga
ttccatccagagggaaaaaacataggtgaagaggtgtacgaacacatctttgacaagggg
tttgacggctgctggcggggctgtaccgtggcttgtgcccacggggtcaaggatttcacc
ccctttaccggaccctacagagggaaaaaggtctttgtggacggccctgagtatgaaacc
attgcagggtgtggatcaaaccttggtatttttgatccttttttcatcctggaggtgaac
ttttactgtgacacctacggccttgacaccatctccatcggaacaggcattgcctttgtc
atggagtgctttgaaatggggctgatcaatgaaacccacaccgggggcatggatttaagt
tttggcaaccgggtcaatgcccttgaactgatccaccagatggccaggggagaagggttc
ggcatgattctgggccagggcatccgccggatgaagacgatctttgcacgggactttggc
gctgacatggccatcatgcaggacatcggcatggaatccaagggactcgagttttccgaa
tacatgaccaaagaatccctggcccagcagggcgggtacggccttgccttaaagggcccc
cagcacgacgaggcctggctcatcttccttgacatggtgcacaacttcatgcccaccttt
gagaacaaggccgaggccctgcactggtttcccatgttccgcacctggtttggtctttgc
ggactgtgcaaactgccctggaacgacattgtaccagaggacaacaagagcacaaaggaa
ccggccaaagtagtcaagcatgtggggtggtacgccgatttcttcacggccgtcacgggc
agacactcaacccccgaggacctcatttccatgagtgaaggcgtatacaacttccagcga
attttcaaccttaagatgggttacggcaccagggaacacgacagcctgccctaccgatcc
atgggaccggtcacccgggacgagtatgaatccaggagcgaacggtatgataaggatctt
gtggaaaaccacaacattgacatatctgccatgaccgtggaagaaaagatggccgtcctg
aggcagaaacgggaggcgaactacgaaaaactcatcgacgccgtgtatgagcgccggggc
tggacccaaaatggcattccgacccttgccacggtgaagcggctgggaatcgacttccct
gaagtggttgccctgcttgccaccaacggaatcaacagttga

DBGET integrated database retrieval system