KEGG   Desulfobacterium autotrophicum: HRM2_08610Help
Entry
HRM2_08610        CDS       T00861                                 

Gene name
fbp1
Definition
(GenBank) Fbp1
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00010  Glycolysis / Gluconeogenesis
dat00030  Pentose phosphate pathway
dat00051  Fructose and mannose metabolism
dat00680  Methane metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
Module
dat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_08610 (fbp1)
   00030 Pentose phosphate pathway
    HRM2_08610 (fbp1)
   00051 Fructose and mannose metabolism
    HRM2_08610 (fbp1)
  Energy metabolism
   00680 Methane metabolism
    HRM2_08610 (fbp1)
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HRM2_08610 (fbp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ACN13974
UniProt: C0QKA3
Position
complement(979019..980974)
Genome map
AA seq 651 aa AA seqDB search
MERDPENMRHLSYLTKEHPSQEAVAEAIINLQAQLNLPKGTEHFISDIHGEYEAFCKVVS
HASGAIKRKIAEIFNDTLSAAEKLELGALIYSPEKMLGIMLPITDDRRQWYQRTLLHLIH
VLRAVSSKYPRSKVQLLIEGRFEMLIEELLYENEQLTDKYEYYQSLLETIITTGQAKIII
INMAKSIQCLAIDHLHIVGDIYDRGPAAHLIMNHLMAYHSADIQWGNHDILWMGAAGGSE
ACIANVIRISLRHANMETLENGYAVSLLPLASFAIETYGDDPCEVFRSQMFNQLDNSQGE
QRLMAQMHKAITIIQFKLEAQIIKRRSEYCLCDRLLYDKIDFDQGTIQINKRAHPLLDKR
FQTVTPEDPYTLTPAEQHVVARLKTAFLNSDKLQQHTRFLFAKGSIYKTCNGNLLYHGCI
PMNNDGSFMSLQINNKNYAGKDLMEKMHRLARQGFFTTDDSPKKQEGLDAMWYLWCGPCS
SLFGKEKMTTFEQYFIADKATHKEPRNIYYTLRDDEGTVRQILEAFALNPDTGHVVNGHV
PVIVKEKESPLKAGGRLIVIDGGFARAYQRKTGIAGYTLVFNSWGILLATHQQDEANSSA
DMEIHDINCTTEIIENQSRRIRIKDSDAGQEIQHRIDELMALKNAYQEGLV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagatccggagaacatgcgccacctgagctacctgacaaaagagcacccatcc
caggaagctgttgccgaggccattattaacctgcaggcccaactcaacctgccaaagggc
accgaacatttcatctcggacattcacggcgaatatgaggccttttgcaaggtggtcagc
catgcctccggcgcaatcaagcgcaaaattgccgaaattttcaacgacactttgtccgct
gcagagaagctagagctgggtgccctcatttattctcctgaaaagatgctgggaatcatg
ttgccgatcactgatgacaggaggcagtggtatcaacggaccttgttacacctgatccat
gtattgcgagcggtttcttcaaaatacccacgttctaaagtacaactgttgattgagggg
cgctttgaaatgttgattgaggagctgctctatgaaaatgaacagctgacggataagtac
gaatactaccagagtctgcttgagacgattatcaccaccggccaggccaaaataatcatt
attaacatggccaagtccatccagtgtctggccatcgatcacctccatattgtgggtgat
atttacgatcgtggccctgcagcccatctcatcatgaatcatttgatggcgtaccacagc
gccgatattcaatggggtaatcatgatatcctgtggatgggagcagcaggcggcagtgag
gcctgtatcgctaatgtcatccggatttccctgcgtcatgccaatatggagactttggaa
aatggatatgcggtgagtcttttgcctctggcttcctttgccattgaaacctacggggat
gacccctgtgaagtttttagatcccagatgttcaaccagctggacaattcacagggtgag
caaaggctgatggcgcaaatgcacaaagccatcaccattatacagttcaagctggaagcc
caaattatcaaacgacggtcggaatactgtctttgtgatcgtttgttgtatgataaaatt
gattttgatcagggaaccattcagataaataaacgtgcccatccactgcttgacaaaaga
tttcagaccgtcaccccggaagatccttacaccctgacacctgcagaacaacatgtggtt
gcacggttgaaaacagcattcctgaacagtgataaattacagcagcatacacgctttctt
tttgccaagggcagtatatataaaacctgcaatggaaatttgctctaccatggttgcatt
cccatgaacaatgacggctcttttatgtcactgcagataaacaataagaattatgcggga
aaggatttgatggaaaaaatgcatcgcctggcccggcagggtttttttaccacagatgat
tccccaaaaaaacaagaggggttggacgccatgtggtacttatggtgcggaccctgttcg
tctctttttggcaaggaaaagatgacaaccttcgaacaatattttattgcagataaagcc
actcacaaagagccacgtaatatctattataccctgcgggacgacgaaggaacggtccga
caaatcctcgaggcctttgcgcttaatcccgatacagggcatgttgtaaacgggcatgta
ccggtgatcgtcaaagaaaaggaaagtccgttaaaggcgggcggcagactgattgtcatc
gacggtgggtttgcgcgggcctaccagagaaaaacgggaatcgccggctacaccctggtt
tttaattcatggggaatactgctggccactcaccagcaggacgaggcaaattcctctgcc
gacatggaaattcacgatattaactgtacgactgaaatcattgaaaaccagagtcgccgt
attcgcatcaaagatagtgatgcaggtcaagaaattcaacaccgtattgacgaactgatg
gctctgaagaacgcttaccaagagggactggtgtaa

DBGET integrated database retrieval system