KEGG   Desulfobacterium autotrophicum: HRM2_08650Help
Entry
HRM2_08650        CDS       T00861                                 

Gene name
pfkB1
Definition
ribokinase PfkB (EC:2.7.1.-)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HRM2_08650 (pfkB1)
   01230 Biosynthesis of amino acids
    HRM2_08650 (pfkB1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_08650 (pfkB1)
   00030 Pentose phosphate pathway
    HRM2_08650 (pfkB1)
   00051 Fructose and mannose metabolism
    HRM2_08650 (pfkB1)
   00052 Galactose metabolism
    HRM2_08650 (pfkB1)
  Energy metabolism
   00680 Methane metabolism
    HRM2_08650 (pfkB1)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HRM2_08650 (pfkB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(984405..985331)
Genome map
AA seq 308 aa AA seqDB search
MIFTVTLNPAVDREMTVDQIVFDTVLRASDWRVDCGGKGFNVARMLKSLGVSSVALGFAA
GKSGELLNDKLQSLGIETEFVWVEGETRTNVSIVSGNGQYVKVNEPGPTITDVDLAQLAQ
KVGDRVRAGDWWVLAGSLPPGVPPGYYTELITLIQSAGAYVFLDTSDEALRQNCGAKPLL
VKPNDEEAHGLTGLPVNTPAQIAAVGRAISAMGPANVIISLGKQGAVLVHAGKAWLAASP
KIVAANPIGAGDSMVAGIVWGLSQGDSMQDALCKGIACGAATASQKGTSVGSLAQVNELL
AKVKLSQV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatatttactgttacactcaatccagcagtagaccgggagatgacggttgatcagatc
gtctttgatactgtcctgcgagcctcggactggcgggtagactgcggcgggaaagggttt
aatgtagcgcgcatgcttaaatcgttaggtgtttcaagtgtggccctcggttttgccgcc
ggtaaaagcggggaattgctcaacgataaactccaatctttggggattgaaactgaattt
gtctgggttgagggagaaacccgcacaaatgtatccatcgtcagtgggaatggacagtat
gtgaaggtcaatgaaccgggcccgaccattacggatgtcgatcttgcgcaactggcgcaa
aaagtaggcgatcgggtacgggccggagactggtgggtgctggccggcagtctgcctcca
ggggtgccgccaggttactatactgagctgataaccctcatccagtcggcaggagcatac
gtattcctggacaccagcgacgaggccctacgccagaactgtggtgcaaagcccttgctg
gttaaacccaatgatgaagaagcacatgggctgaccgggcttcctgttaacacgcctgcc
cagatcgcagcagttggcagggcaatctctgccatgggccctgcaaacgtgattatttcc
cttggaaaacagggtgccgtactggtccatgcagggaaagcgtggctggcagcaagtccc
aaaatagttgcagccaacccaattggggcaggtgattccatggttgccgggattgtgtgg
ggactcagccagggggatagcatgcaggatgccttgtgtaaaggaattgcctgtggtgct
gctacagccagtcaaaaaggcacatcggttggttcccttgcacaggtaaacgagttgtta
gcaaaagttaagctcagccaggtgtag

DBGET integrated database retrieval system