KEGG   Desulfobacterium autotrophicum: HRM2_11060Help
Entry
HRM2_11060        CDS       T00861                                 

Gene name
thrC
Definition
(GenBank) ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HRM2_11060 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HRM2_11060 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HRM2_11060 (thrC)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HRM2_11060 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1257537..1259042)
Genome map
AA seq 501 aa AA seqDB search
MKPDNFPKEIQPFLVPSPCGDLCYRCLGCKGEFPITKLLYVCPDCGEVLLIEDRDIQRLN
KISGTTWQQIFDYRRMLKIPALKGIYRYHEFIGPNIPLESIVYLGEGHTPIVEANQRLQD
LAGIRFFYKNDGQNPSASFKDRGMASALSYIKYLIDQQLVSDIIAVCASTGDTSAAAALY
ASYLQPHIKSAVLLPHNKVTPQQLSQPLGSGASVFEIPGVFDDCMKIVEKLSEEYNVALL
NSKNAWRILGQESFSYEVAQDFEYEMHDKVIVVPIGNAGNISALMSGFIKFFNAGIITDL
PKIIGVQSEHADPVFQYYLEPDRSKRQFKPVTVKSSVAQAAMIGNPVSMPRVIALADRYN
TLAGEQRVFVTQVTEQAIMDWQLEANRNGHIACTQGGESLAGLVEALKQGIVTKTETAIV
DATAHAMKFSGFQDLYFSEKIPEAFNIHSNQRFINRPKLVMPKDKKNIPGQGTPLGREDF
NRFAEDVSKTIAQELNLTTNL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgataactttccaaaagagatccagccgtttcttgttcccagtccctgcggg
gatctatgctaccgctgccttggatgcaagggggaatttcccatcaccaaacttctttat
gtctgtcccgactgcggggaggttcttctcattgaggatagggatatccaacggctcaac
aaaatttcaggcaccacctggcagcagatctttgactatcgacgaatgctcaagattccg
gccctcaaaggaatctaccgctaccatgagtttatcgggcccaatatcccccttgaatcc
attgtctatctcggtgaaggccacaccccgattgtggaggccaaccaacgactccaggat
cttgcagggattcggttcttttacaagaacgacggacagaaccccagtgcatcgttcaaa
gaccggggcatggcaagcgccctttcctacatcaaatacctcattgaccagcaacttgtg
tcagacattattgccgtgtgtgcctccaccggagatacctcagccgctgcagccctttac
gcgtcctatcttcagccacacatcaaatcggccgtacttctgccccacaacaaggtgacc
ccccagcagctctcccagccccttggaagcggcgccagtgtgtttgaaattcccggcgta
tttgacgactgcatgaaaatagtggagaaactgtccgaagagtacaacgtggcgttgctc
aactcaaagaacgcctggcgcatccttggccaggagtctttttcctatgaggttgcccag
gattttgaatatgagatgcacgacaaggtgatcgtggttcccattggcaatgccggaaat
atttcagccctgatgagcggtttcatcaaattcttcaatgccggaatcattacggacctg
ccaaagatcatcggcgtccagagtgagcacgcagaccctgttttccagtactatcttgag
ccagaccgatcaaaacggcagtttaagcccgtgacggtgaaatcaagtgtagcccaggca
gccatgatcggcaatcccgtttccatgcccagggtcattgccctggcagaccgatacaac
acacttgccggtgaacaacgggtgtttgtaacccaggtaacagagcaggccatcatggac
tggcagcttgaggccaaccgaaacggacacattgcctgtacccagggcggcgaaagcctt
gcagggctggttgaagcccttaaacagggcattgtcaccaaaacagaaactgccatcgtt
gatgcaacggcccatgccatgaaattttccggattccaggacctctacttcagtgaaaag
ataccagaggccttcaacattcattccaaccagaggttcatcaaccgcccaaaacttgtg
atgcccaaggacaagaaaaatatccccggccagggaaccccccttggcagggaagatttt
aaccggtttgctgaagatgtatcaaaaaccattgcacaggaactgaaccttaccacaaac
ctatga

DBGET integrated database retrieval system