KEGG   Desulfobacterium autotrophicum: HRM2_11060Help
Entry
HRM2_11060        CDS       T00861                                 

Gene name
thrC
Definition
(GenBank) ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00260  Glycine, serine and threonine metabolism
dat00750  Vitamin B6 metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01230  Biosynthesis of amino acids
Module
dat_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HRM2_11060 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HRM2_11060 (thrC)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HRM2_11060 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ACN14218
UniProt: C0QLD2
Position
complement(1257537..1259042)
Genome map
AA seq 501 aa AA seqDB search
MKPDNFPKEIQPFLVPSPCGDLCYRCLGCKGEFPITKLLYVCPDCGEVLLIEDRDIQRLN
KISGTTWQQIFDYRRMLKIPALKGIYRYHEFIGPNIPLESIVYLGEGHTPIVEANQRLQD
LAGIRFFYKNDGQNPSASFKDRGMASALSYIKYLIDQQLVSDIIAVCASTGDTSAAAALY
ASYLQPHIKSAVLLPHNKVTPQQLSQPLGSGASVFEIPGVFDDCMKIVEKLSEEYNVALL
NSKNAWRILGQESFSYEVAQDFEYEMHDKVIVVPIGNAGNISALMSGFIKFFNAGIITDL
PKIIGVQSEHADPVFQYYLEPDRSKRQFKPVTVKSSVAQAAMIGNPVSMPRVIALADRYN
TLAGEQRVFVTQVTEQAIMDWQLEANRNGHIACTQGGESLAGLVEALKQGIVTKTETAIV
DATAHAMKFSGFQDLYFSEKIPEAFNIHSNQRFINRPKLVMPKDKKNIPGQGTPLGREDF
NRFAEDVSKTIAQELNLTTNL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgataactttccaaaagagatccagccgtttcttgttcccagtccctgcggg
gatctatgctaccgctgccttggatgcaagggggaatttcccatcaccaaacttctttat
gtctgtcccgactgcggggaggttcttctcattgaggatagggatatccaacggctcaac
aaaatttcaggcaccacctggcagcagatctttgactatcgacgaatgctcaagattccg
gccctcaaaggaatctaccgctaccatgagtttatcgggcccaatatcccccttgaatcc
attgtctatctcggtgaaggccacaccccgattgtggaggccaaccaacgactccaggat
cttgcagggattcggttcttttacaagaacgacggacagaaccccagtgcatcgttcaaa
gaccggggcatggcaagcgccctttcctacatcaaatacctcattgaccagcaacttgtg
tcagacattattgccgtgtgtgcctccaccggagatacctcagccgctgcagccctttac
gcgtcctatcttcagccacacatcaaatcggccgtacttctgccccacaacaaggtgacc
ccccagcagctctcccagccccttggaagcggcgccagtgtgtttgaaattcccggcgta
tttgacgactgcatgaaaatagtggagaaactgtccgaagagtacaacgtggcgttgctc
aactcaaagaacgcctggcgcatccttggccaggagtctttttcctatgaggttgcccag
gattttgaatatgagatgcacgacaaggtgatcgtggttcccattggcaatgccggaaat
atttcagccctgatgagcggtttcatcaaattcttcaatgccggaatcattacggacctg
ccaaagatcatcggcgtccagagtgagcacgcagaccctgttttccagtactatcttgag
ccagaccgatcaaaacggcagtttaagcccgtgacggtgaaatcaagtgtagcccaggca
gccatgatcggcaatcccgtttccatgcccagggtcattgccctggcagaccgatacaac
acacttgccggtgaacaacgggtgtttgtaacccaggtaacagagcaggccatcatggac
tggcagcttgaggccaaccgaaacggacacattgcctgtacccagggcggcgaaagcctt
gcagggctggttgaagcccttaaacagggcattgtcaccaaaacagaaactgccatcgtt
gatgcaacggcccatgccatgaaattttccggattccaggacctctacttcagtgaaaag
ataccagaggccttcaacattcattccaaccagaggttcatcaaccgcccaaaacttgtg
atgcccaaggacaagaaaaatatccccggccagggaaccccccttggcagggaagatttt
aaccggtttgctgaagatgtatcaaaaaccattgcacaggaactgaaccttaccacaaac
ctatga

DBGET integrated database retrieval system