KEGG   Desulfobacterium autotrophicum: HRM2_11100Help
Entry
HRM2_11100        CDS       T00861                                 

Gene name
pcm
Definition
hypothetical protein (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dat  Desulfobacterium autotrophicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262221..1262877
Genome map
AA seq 218 aa AA seqDB search
MNSEQRKFEIWRHKMVARQIVARGITDPGVIAAMETVPRHLFVSEALTDSAYGDFPLPIG
EAQTISQPYIIAEMTQALELTGDERVLEIGTGSGYQAAVLAEIVFRVYTIERNNILFLRT
RKLFDALKYHNIVARYSDGTLGWKEEAPFDAILVTAGGTQIPQPLLDQLAVGGRLVMPVG
GLCSQELVRIEKKADKITTDNLGGCRFVKLIGEHGWKE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaacagagaaagtttgagatatggcgtcataagatggtcgctcggcagatc
gtggccagggggattaccgaccccggggtcattgccgccatggaaacggtgccccggcat
ctttttgtgagtgaggcccttactgacagtgcctatggggatttcccccttcccattggg
gaggcccagaccatatcccagccttatatcatcgccgaaatgacccaggccctggagctc
actggagatgaaagggtgcttgagatcgggacaggctcagggtaccaggcagcagtgctt
gcagagattgttttcagggtctataccattgagcgtaacaacattctgttcttaagaacc
agaaaactttttgatgcgcttaaatatcacaatattgttgccaggtattccgatggcact
ctggggtggaaagaggaggcgccgtttgatgccatccttgttaccgccggtggtactcag
attccccaacctctccttgaccagcttgccgtgggcggcaggttggttatgcctgtggga
gggttgtgcagtcaggagcttgttcggattgaaaaaaaagccgataaaattaccacggat
aatctcggaggctgccgttttgtaaagctgatcggcgagcacggctggaaggaatag

DBGET integrated database retrieval system