KEGG   Desulfobacterium autotrophicum: HRM2_15340Help
Entry
HRM2_15340        CDS       T00861                                 

Gene name
dcyD1
Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HRM2_15340 (dcyD1)
Enzymes [BR:dat01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     HRM2_15340 (dcyD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1757191..1758201
Genome map
AA seq 336 aa AA seqDB search
MKLYRLPRYVLAEFPTPVDFLESFSKLNNGPKIYMKRDDLTSLGMGGNKTRKLEFLVGEA
LDQGKDTLVTAGGLQSNHCRLTAAAAGKAGLDCHLVLNGNCPETASGNLLLDKIFGAQIH
YCDRKDRDQRLYQVADTLQNQGKRPYVIPVGGSNGVGSVGYVNAMVELHAQLTQMKVQPD
AIVFATSSGGTQAGLTLGAELTGFKGQVLGISIDQVKTGKNPFPPVLLEIARATAQRLGI
STELTEQDFSLNCDYLGAGYAVPADLEFNAIRDLARCEGILLGPVYTARAMGGLMDLIQQ
GVFKKGQTVLFWHTGGSPELFAWSSQLGSQSGSFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatcgtttgccaagatatgtcctggctgaatttccaaccccggttgatttt
cttgagtcgttttcaaaattgaacaacggacccaaaatatatatgaagcgggatgacctt
acttccctgggcatgggcggcaataaaacaaggaagcttgaattcctcgttggcgaagcc
ctggaccagggtaaagataccctggttaccgcaggagggctgcaatccaaccactgccgt
ctgacagcggctgccgccggaaaagccggccttgactgccatctggttctaaacggcaat
tgtcctgaaacggccagcggcaatctgctgctggataaaatattcggggcccagatccat
tattgtgacaggaaagacagggaccagcgactctaccaggtggcggacacccttcaaaac
caggggaaacgtccctatgtcattcccgttggcggatccaacggcgtggggtctgtgggt
tatgtgaacgccatggtggaactccatgcccagcttacgcagatgaaggtccagcccgat
gccattgtgtttgccacaagttccggtggtacccaggcaggcctgaccctgggtgcagag
ctaacagggtttaaggggcaggtcctgggcatcagtattgatcaggtcaaaaccggaaaa
aatccttttcccccggttctccttgaaattgccagggcaacggcccaaaggcttggtatc
agtacggagttgacagaacaggatttttctcttaattgtgattacctgggtgcaggctat
gccgtgccggcagatctggagtttaatgccattcgggatctggccaggtgcgagggcatt
ctgcttggtccggtgtataccgcccgtgccatgggggggctgatggacctgatccaacaa
ggggtatttaaaaaaggccagaccgtcttgttctggcataccggcggatctccggaatta
tttgcatggtcaagtcagttgggctcacaatccgggtcgtttgaaggataa

DBGET integrated database retrieval system