KEGG   Desulfobacterium autotrophicum: HRM2_16450Help
Entry
HRM2_16450        CDS       T00861                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dat  Desulfobacterium autotrophicum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dat03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1891075..1891674)
Genome map
AA seq 199 aa AA seqDB search
MDLYPESILNLIKSLSTLPGIGRRTAERLALHILHAPLHEAQTLANDILELKQKVTLCRT
CFSLSDQPECRICSNPRRDASIICVVEKPTDIVAIEKSGAFSGLYHVLGGALSPMDGIGP
DELRIRELFSRACSKTTTEVIIATGTNVEGEATAAYISDQLRKKGVNVTRIASGVPMGGD
FQYVDQVTMQRAMEGRRGF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggacctctatcccgaatccatcctgaacctgatcaaaagcctgtcaacgcttccggga
ataggaaggagaactgccgagcgcttggcgcttcacattctacatgccccccttcacgag
gcacaaacccttgccaacgacatccttgagcttaaacaaaaggtgacgctttgcaggacc
tgcttttccctgagcgaccaaccagagtgccggatatgcagtaacccacggcgggatgca
tcaatcatctgtgttgtggaaaagcccactgacattgtggccattgagaaatcaggtgca
ttttcaggactttaccatgttcttgggggggcactttcacccatggacggcattggaccg
gacgagctgaggatacgcgaacttttttcaagggcctgttctaaaacaacaaccgaagtg
atcattgccacggggaccaatgttgaaggcgaggcaacagccgcctatatttcggaccaa
ctccgaaaaaaaggcgtcaatgtgacacgaatcgcttcaggcgtccccatgggtggcgat
tttcaatatgttgaccaggtaaccatgcaacgggcaatggagggcagacgtggattctga

DBGET integrated database retrieval system