KEGG   Desulfobacterium autotrophicum: HRM2_16790Help
Entry
HRM2_16790        CDS       T00861                                 

Gene name
ispE
Definition
protein IspE (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dat00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1924611..1925516
Genome map
AA seq 301 aa AA seqDB search
MIERAFSPAKINLFLYVTSRRDDRYHELYTLMTCLDFGDRLSFDYTCPGVAVVCDHPDVP
EDCTNLVHRAATLFFDAFSRIKPFCKKKTGVCVSIHKKIPVGAGLGGGSSNAAVTLQVLN
RRFGSPFSKQALMAMGLKLGTDVPFFIHGGPALARGVGEQLLICAPLLPYHVVVYFPGLS
VRTSLVYENVNLALTKKVKTNNNAVLNAHGKGQPLDVKGLLHNDLEPVACRIYPALIRVR
EDMAGFKPDGLLMTGSGSSYFALFSDGLKAQQAFKLLSETTDEPHGRVFMASFLKGNDFT
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaacgggcgttttcaccggcaaagatcaatctctttctttatgtgaccagcaga
agagatgaccgataccacgagctttacaccctgatgacctgccttgattttggtgaccgt
ctatcctttgattatacctgtccgggcgtggctgttgtctgtgaccacccggatgtgccg
gaagattgtaccaatctggttcacagggcagccacccttttttttgacgcattttccaga
attaaacctttttgcaaaaaaaagaccggggtttgtgtgtctattcataaaaagatccct
gtgggtgcgggtctggggggaggcagttccaacgctgcagtcaccctgcaggttctcaac
cgacggtttggttcgcccttttctaaacaggccctcatggccatggggctcaagctggga
acagatgtgcctttttttatccatggcgggccggcccttgcccggggagtgggtgaacaa
ctcttaatctgtgcgccgcttctgccataccatgtggttgtatattttccagggcttagt
gtccgaacctcactggtttatgaaaatgtcaatttggcattgacaaaaaaggtaaaaacg
aataataatgctgttttaaatgctcatgggaaaggccaacccctggatgttaaagggctt
ttgcacaatgatcttgaaccggttgcctgcaggatttaccctgctcttatccgggtaagg
gaagatatggccggatttaagccggatgggttgcttatgacgggcagtggttcttcttat
tttgcgcttttttccgatggcttaaaggctcagcaggcctttaagcttctgtcggaaaca
acagatgaaccccatgggcgtgtgttcatggcatcatttttaaagggcaatgattttaca
gaataa

DBGET integrated database retrieval system