KEGG   Desulfobacterium autotrophicum: HRM2_17160Help
Entry
HRM2_17160        CDS       T00861                                 

Gene name
dxr
Definition
(GenBank) Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00900  Terpenoid backbone biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HRM2_17160 (dxr)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HRM2_17160 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ACN14822
UniProt: C0QB23
Position
1965725..1966876
Genome map
AA seq 383 aa AA seqDB search
MIKRLSILGSTGSIGTSALDVVMLHPDLFDVRVLAAATNIDLLARQIRVFKPETVVVLDE
IHAARLADLLAGGPVPEILFGDSGYARGANHEKVDLVLLAMVGAAGLLPAIAAIEARKEV
ALANKETLVMAGDLVMGLARKNKVSILPVDSEHSAIFQCLAGNQARDLKKIFLTASGGPF
LHTPQKEFSAIKPEHALSHPTWSMGHKISIDSATLMNKGLEIIEAVHLFDLSIDQVEVIV
HPQSIVHSMVGFNDGSVMAQMGVPDMRTAIALAFSWPHRLTLDLDFPDFTALGGLVFERP
DSSRFPSIGFAVEACRQRGTLPAVMNAANEIAVQAFLTARIDFSGIFTMVEKTMALHQRV
DDPTLSDILEADKWARQTALALI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacgtttatccattcttgggtcaaccggttccattggcacgagcgcccttgac
gtggtgatgctgcacccggatctgtttgatgtgcgggtgctggctgcagctaccaatatc
gatcttctggcccggcagatcagggtctttaaaccggaaactgttgtggtcctcgacgag
atccatgccgcaaggctggcggatctccttgccggcggacctgtccccgagattcttttt
ggcgattctggttatgcccggggggcaaaccacgaaaaggtggatttggtgctccttgcc
atggtcggagccgcaggtcttttgccagccattgccgcaatcgaggcccgaaaagaagtg
gcccttgccaacaaagagacccttgtgatggcaggcgaccttgtcatgggacttgcccga
aaaaataaggtctccatccttcctgtagacagtgagcattcggccatatttcagtgcctt
gctggaaatcaggcaagggatctcaaaaagatttttttaacggcttcgggcgggccgttt
ctccatacgccacagaaagaattttcagccataaaacctgaacacgccctgagccatccc
acctggagcatgggccacaaaatctccattgattctgcaaccctcatgaataaggggctt
gaaattatcgaagcggtccaccttttcgatctttccatagaccaggtggaggtgattgtc
catccccagagtattgttcactccatggtgggctttaacgacggttcggtcatggcccag
atgggagtgccggacatgcgcacggccatcgcccttgccttttcctggccccaccggctg
acccttgatcttgactttcccgattttacggcccttggtggtctcgtgtttgaacgaccg
gactcaagtcgttttccttcaatcggatttgccgttgaggcctgccgacaacggggcacc
ctgccggcggtgatgaatgcggcaaacgagatagcggttcaggcgtttttaacggccagg
atagatttttccggcatttttaccatggtcgaaaagaccatggcactccaccagagggtt
gacgatcccaccctttcggatatattagaagcagataaatgggcaaggcagacggctttg
gcccttatctag

DBGET integrated database retrieval system