KEGG   Desulfobacterium autotrophicum: HRM2_17650Help
Entry
HRM2_17650        CDS       T00861                                 

Definition
putative lysophospholipase L2 (Lecithinase B) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HRM2_17650
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HRM2_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2020295..2021320
Genome map
AA seq 341 aa AA seqDB search
MLTLRDLEKLKSSALLVFFKIFEPLTGLKKTLLKGADLSGMGNDGFDIDWFYGAHGHRLR
YGRLDGSDTGANKVVLLLNGRSEFLEKYVEVAEELVSRGYTVLSFDWRGQGLSVRELENR
QKGYVKTFEDYLADLAVFYRQIVIPLDFPVTLLAHSMGGHLGLRFMHDNPHAFSRAVLVS
PMIDIVTLPFPSFAARRIAKIACAAGFGEAYVLGGTNYAPGKVCFDTNRLTHDLERFNHE
ERLIAQIPDLALGDVTYAWLKAAFDSIQLLKVKSYAGQIGTPVMLVSADEDRVVSIAAQR
RMARDLPDCRLVCLPNARHEILHETDGIRRAFWKHFDAFTA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccctaagggacttggaaaaattaaaatccagcgccctattggtgttttttaaa
atttttgagcccctaaccgggttgaaaaagacccttttaaaaggagcggatttgtcaggt
atgggtaacgacggatttgacattgactggttctatggtgcccatggccatcggttgcgg
tatggtcggctggatggttctgatacaggggcaaacaaggttgttctcctcctgaacgga
aggtccgagtttcttgagaaatatgtcgaagttgcagaagaacttgtttcaaggggttac
acggttttaagttttgactggcgggggcaggggttgtccgttcgagagcttgaaaaccgg
caaaagggatatgttaaaacctttgaggattatcttgcggatcttgccgttttttaccgg
cagatcgtcattccccttgattttcccgtcacacttctggcccactccatgggcggtcac
ctgggcctgagattcatgcacgacaacccccatgccttttccagggccgttcttgtctct
cccatgattgatattgtcactttgccctttccttcctttgcagcaaggcgtattgcaaaa
atcgcctgtgctgcaggatttggcgaggcctatgtcctgggcggaaccaattacgccccg
ggcaaagtttgttttgataccaatcggttgacccatgacctggagcggttcaaccatgaa
gaacgactcatcgcacaaataccggaccttgccctgggggatgtgacctatgcatggctc
aaggctgcctttgactcgattcaactgctcaaggtaaaatcatatgccgggcagattggg
acgccggtgatgcttgtcagtgcagacgaggacagggtggtatcgatcgcggctcagcgg
cgcatggcaagggacttgccggactgccggttagtttgtctgcccaatgcccgtcacgag
attctccatgagacagacggaatccgaagggccttctggaagcattttgatgcttttact
gcctga

DBGET integrated database retrieval system