KEGG   Desulfobacterium autotrophicum: HRM2_18340Help
Entry
HRM2_18340        CDS       T00861                                 

Gene name
glpK
Definition
protein GlpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HRM2_18340 (glpK)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HRM2_18340 (glpK)
Exosome [BR:dat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HRM2_18340 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2086546..2088063
Genome map
AA seq 505 aa AA seqDB search
MTEYVGAVDQGTTSTRFIIFDHNGDIVGFDQKEHRQIFAKPGWVEHDPMEIWENTKKVIQ
GALQKTGIAGHKIKAVGVTNQRETVVVWDRKTGRPFHNAVVWQCARTDEICQKLIRDGGQ
DRFRKTTGLPVATYFSGPKIQWILDNVPEAKKAALAGDAMFGTMDTWTIWNLTGGPNGGA
HVTDVTNGSRTLLMDINTLEWSPEILSILNIPASGLPRIRPSSDPNFYGLTTKDGPMAAQ
VPVCAALGDQQAALFGQTCFEPGEAKNTYGTGCFLLLNTGTRPVASTHGLITTPAYQLGK
SSPVYALEGSIANAGALVQWVRDNLGLIKDAREIEALASLVADNGDVYCVPAFSGLFAPY
WRSDARGVIAGLTRYANKSHIARAVLEATAYQALDIVDAMNLDSGVALTSLKVDGGMVHN
RLLMQFQADLLKVPVIVPRVTETTALGTAYAAGLAVGFWSGTAELKAKWSIQTTFSPAMD
EAERTKRCAGWKKAVERTLNWVDPL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatatgtcggcgccgttgaccagggaaccaccagcacccggttcatcatcttt
gatcacaatggagatattgttggctttgatcaaaaggagcaccggcagattttcgccaaa
ccgggctgggtggagcatgaccccatggagatctgggagaatacaaaaaaggtgatccag
ggcgcccttcaaaaaaccggtattgcaggtcataaaatcaaggctgtaggggtcaccaat
cagagggagaccgttgtggtatgggatcgaaaaacaggtcgtcctttccataacgccgtg
gtgtggcagtgtgcaaggaccgacgagatctgccagaagctcatcagggacgggggccag
gaccggttccgaaagaccacagggcttcccgttgccacctatttttcagggcccaagatc
caatggatactcgataatgtgcctgaggcaaaaaaagcggcccttgcaggagatgccatg
ttcggtaccatggatacctggaccatatggaaccttaccggtggtcccaatggcggtgcc
catgtcacggatgtaaccaatgggagccgaacccttctcatggacatcaacacccttgaa
tggagtccggagattctttctattctgaacatccctgcgtccgggcttccccggattcga
ccctcatccgatccaaacttttacggcctgaccacaaaggacggccccatggctgcccag
gtgccggtctgtgccgcccttggggatcagcaggctgcattgttcggccagacctgtttt
gagccgggggaggcgaaaaatacctatggaacaggttgttttcttcttttaaacacggga
acccgaccggttgcctccacccacggtttgatcaccacgcctgcctatcagttgggcaag
tcttctccggtttatgcccttgaaggatccattgccaatgccggtgcccttgtccagtgg
gtcagggacaacctcgggttgatcaaggatgcccgggagatcgaggccctggcctccctt
gtggcggacaatggggacgtctattgcgtgcccgccttttctgggctgtttgccccctac
tggcgatcggatgccaggggtgtgattgcaggactcacccggtatgcaaacaagtcccac
attgcccgggcagttctggaggcaacggcctatcaggcccttgacattgttgatgccatg
aaccttgactcgggcgttgccctgacaagcctgaaggtggacggcggcatggtccataac
cgactgctcatgcaattccaggctgatcttctcaaggtgccggtgatcgttcccagggtg
accgagacaacggccctgggaactgcctatgccgcagggcttgccgtggggttctggtcc
gggacagcggaactcaaggccaaatggtcaatacagaccaccttttctccggccatggac
gaggcagaacgtacgaaaaggtgcgccggctggaaaaaggctgttgaacgtaccctgaac
tgggtagatcccctgtaa

DBGET integrated database retrieval system