KEGG   Desulfobacterium autotrophicum: HRM2_22130Help
Entry
HRM2_22130        CDS       T00861                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dat01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dat01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dat00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dat00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dat00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dat00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dat00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2498890..2500278)
Genome map
AA seq 462 aa AA seqDB search
MPTETIPYSKESAMKEKTITTKIETLGEAKVLSPLAAKAQGGYTERFVKDEDRVLIDVNL
NKIKDTIKNNVEPPSFEKAGPREKIYFDPSKLKCAIVTCGGLCPGLNDIIRSVVLELYHC
YGVKNIYGIRHGLQGFIPEFGHEVMELTAASVSNILDMGGTILGSSRGTQDIGTIVDCLE
RMNIGILFMVGGDGTLVAAKKIAETITERNLKVSIIVIPKTIDNDIYLVSRTFGFDTAVD
IATIAIKGAHNEARGYPNGIGLIKLMGRHSGFLAATAALAQQDANFVLIPEIEIQLTGEN
GFLAALERRMKERKHAVIVVAEGAGQRFFENQTTEYDPSGNIKLKDIGTFLKNEISQWFK
ERNNPVTLKYIDPSYIIRSLPANSNDCVYCGFLGRDAVHAGMAGKTKLLVSNWNNHYVHI
PMEASAGQRKYVDPKGKLWQSVLEATGQGALINGKAHETHPA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgaaaccatcccctatagtaaggagagtgccatgaaagaaaaaacgataacc
accaaaattgaaacccttggagaagcaaaggtcctctctccccttgctgcaaaggcacag
ggtgggtacacagaacggtttgtcaaagatgaagaccgggtgctcattgatgtgaatctc
aacaagattaaagacaccatcaaaaacaacgttgaaccaccaagctttgaaaaggcaggt
ccaagggaaaaaatctactttgatccgagcaaactcaaatgcgccattgtcacctgcggt
ggactatgccctggactcaacgacatcatacgatcggttgtacttgaactctaccactgc
tacggggtcaagaatatctacggcattcgccacggccttcagggatttatacccgagttt
ggccatgaggtcatggaattgacagcagcttcggtatcaaacattcttgacatgggtggc
accatacttggcagttccaggggcacccaggatatcggcaccattgtcgactgcctggaa
cgcatgaacatcggcattctgttcatggttggtggagacggcaccctggtggcagccaaa
aaaattgcagaaaccatcaccgaacgtaacctcaaggtgagcatcattgtcatccccaag
accatagacaacgacatctacctggtttccaggaccttcgggtttgacacggccgttgac
atcgcaaccatagccatcaagggtgcccacaacgaggcaaggggatatcccaacggtatc
ggattgatcaagctcatgggccgccactccggatttctggctgccacggcagcccttgcc
cagcaagatgctaatttcgtactcattcccgagatagaaatccagctcaccggtgaaaac
ggatttttagctgccctggagcgcaggatgaaggagagaaaacacgctgtcatcgtagtt
gccgaaggggcgggtcagcgtttttttgaaaatcagaccaccgaatatgatccgtcaggc
aacattaagctcaaggatattggcacctttttaaaaaacgaaatctcccagtggtttaaa
gagcgaaacaaccccgtaaccctgaagtatatcgacccgagctacataatcaggagtctt
cccgccaattcaaacgactgcgtttactgcgggttccttggaagggacgccgtccatgcg
ggcatggccggcaagaccaagcttctggtcagcaactggaacaaccactatgtccatatt
cccatggaggcttcagctggacaaaggaaatacgtggatccaaagggaaagctatggcag
tcggtcctggaggccacgggccagggtgccctgatcaacgggaaagctcacgaaactcac
cctgcttga

DBGET integrated database retrieval system