KEGG   Desulfobacterium autotrophicum: HRM2_23620Help
Entry
HRM2_23620        CDS       T00861                                 

Gene name
glgB2
Definition
protein Glprotein GB2 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dat00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2700811..2702844
Genome map
AA seq 677 aa AA seqDB search
MKECCKDPCSPDPGIFRDSFLLPHREEILRRIGHCQQKYERITQKGHRSLEKFAMYHKEF
GLHRLNSGWIFREWAPNATAIHIIGEMTQWQIDPEFCLERKTADGVWEASFPLGAFFHKA
LYRLVVTWKGGRGDRLPTAVTRVVQDPDSLIFNAQVWEPESPYMWRHSSPDPADLFIYET
HVGMAQETWGVGTFKEFETRVLPRIKTAGYTAIQIMAVQEHPYYGSFGYHVTNFFAVSSR
FGTPEEFKSLVDAAHGLDLKVFMDVVHSHSSSNEIEGLSRFDGSLDQFFHSGDRGIHRLW
DSRCFDYGKPMVLNFLLSNLRYWIEEFHLDGFRFDGVTSMLFYDHGLGRAFTCYDDYYGN
SVDLDALAYLYLANRFVHAMIPNCVTIAEEVSGYPGIATSQSDGGTGFDYRYAMGIPDFW
IRLLKEYRDEQWPLSLLWQELNSRREDERTISYAESHDQAMVGDKTLMMHLMGRAIYSCM
ERTNTSITTFRAVALHKMIRLITLATAGNGYLNFMGNEFGHPEWIDFPSAANNWSYQHAR
RQWSLVDNEDLMFSCLARFDRAMVKTAKDHGILNASRARLIFVHEADKTIGFMRAGMIFV
FNFHPDKSFVDYPVNAPTGRFKMVLDTDATGFGGHGRLRADQVHLTLKGGAIQNDNSQLS
LYLPARTAIVLAPGKGQ
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatgctgcaaagacccatgttcccctgatcctggcatttttcgggacagtttc
ctcctgccccacagggaggaaattctcaggcggatcggacattgtcaacaaaaatacgaa
aggatcacccaaaaaggccacagatcccttgaaaaatttgccatgtaccacaaggaattc
gggctccatcgtctcaacagcggctggatcttccgggagtgggcgcccaatgccacggcc
atccatatcatcggggagatgacccaatggcagattgatccagaattctgccttgaacgt
aagacggccgatggcgtgtgggaggcaagtttccctttgggagcattttttcacaaggct
ctttacaggctggttgtcacctggaaagggggcaggggggacaggttgccgacagctgtc
acaagggttgtccaggatccggattccctgatattcaatgcccaggtgtgggaaccagaa
agcccctatatgtggcgtcactcctctcctgatcctgccgatctttttatctatgagacc
catgtgggcatggcccaggaaacgtggggagtgggaaccttcaaggagttcgagacccgg
gtgctgccaaggatcaagactgcaggctacactgccatccagatcatggctgttcaagaa
catccctattatggatcgttcggataccatgttaccaatttttttgccgtctcctctcga
ttcggaacccctgaagagtttaaaagtcttgtggatgcagcccatggcttggatcttaag
gtgttcatggacgttgtccactcccattcatcctcaaacgagatcgagggtttgagccgc
tttgacgggagcctggatcaatttttccattccggggaccggggaattcaccgattgtgg
gattcccgctgctttgattatggcaaacccatggtccttaactttcttctttccaatctg
cgctactggatcgaagaatttcacctggacggtttccggtttgacggggtgacaagcatg
ctgttttacgaccatggccttggccgggcctttacctgctatgatgactactatggcaac
tcggttgatctggatgcccttgcctatctctatcttgccaaccgttttgttcacgccatg
atcccaaattgcgtgaccattgccgaagaggtgagcggctaccctggcatcgcaacctcc
cagagcgacgggggaaccgggtttgattatcgttacgccatgggtatccctgatttttgg
attcgcctgttaaaggagtaccgggacgaacaatggccccttagccttctatggcaagag
ctcaactccaggcgtgaagacgaacgaaccatctcctacgccgaatcccatgaccaggcc
atggtgggggacaagactctgatgatgcacctcatgggaagggctatctattcgtgcatg
gaacgaaccaacacctccatcacaacctttcgtgccgtggctctccacaaaatgatccgg
ctcatcacccttgcaacggcaggcaacggttatctcaacttcatgggcaatgagtttggc
catccggaatggattgattttccaagcgctgccaataactggtcatatcagcatgccaga
cgccagtggtccctggtggacaatgaagatctgatgttctcctgccttgcccggtttgac
agagccatggtcaaaacggcaaaggaccacgggattttgaacgcttcccgggctaggctg
atttttgtccatgaggcagacaagaccattggattcatgagggcaggaatgatttttgtc
tttaattttcacccagataaatcgtttgttgattaccccgtcaatgcacctaccggtaga
tttaaaatggtccttgacacggatgccacagggtttggaggccatgggcggcttagggct
gaccaggttcatcttaccctcaaagggggggcgatccaaaacgacaattcacagctgagt
ctctaccttccggcccgaaccgctattgtcctggcccctgggaagggacagtga

DBGET integrated database retrieval system