KEGG   Desulfobacterium autotrophicum: HRM2_23650Help
Entry
HRM2_23650        CDS       T00861                                 

Definition
putative lipase/hydrolase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dat01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704485..2705108
Genome map
AA seq 207 aa AA seqDB search
MKPLPFLLAAIIVLAGIRDPLSARESVTRILFVGDSITAGFGVDPEQSYPVLVDQLLRQK
GFNNIEITNGSISGSTTASALSRLKWFLRIKPHILVLALGANDGLRGLSTVEMEQNLDRT
ILLALENGIQVILAGMEVPPNYGPRYSAAFRKVFPSLASHHNIALIPFLLKDVAGIASLN
QADGIHPNQAGQEIIATTVLPYLLDQL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttgccttttttgcttgccgcaattatcgtccttgccggcatccgtgatccc
ctgtcggcccgggaaagtgtgacccgaattctttttgtcggcgattcgattaccgcaggt
ttcggcgtcgaccctgaacagagctacccagtccttgtggatcaactgctccgccaaaag
ggatttaacaatatcgagatcaccaacgggagcatcagcggttccacaacggccagtgcc
ctttcccggctcaaatggtttttaagaattaaaccccatatcctggtgctggccctgggg
gccaatgacggattgcggggactctccaccgttgaaatggaacaaaacctggaccggacc
atcctccttgccctggaaaacggtatccaggtcattcttgcgggcatggaggtgccgccc
aattacggcccccggtattcagccgcattcagaaaggtttttccgtcccttgcaagccac
cacaacattgccttgattccttttttactaaaggatgtggcgggtattgccagcctcaac
caggcagacgggatccatcccaaccaggctgggcaggaaattattgccaccacagtgctt
ccctatctgctggatcaactgtga

DBGET integrated database retrieval system