KEGG   Desulfobacterium autotrophicum: HRM2_23650Help
Entry
HRM2_23650        CDS       T00861                                 

Definition
putative lipase/hydrolase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HRM2_23650
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HRM2_23650
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HRM2_23650
Lipid biosynthesis proteins [BR:dat01004]
 Fatty acid synthase
  Component type
   HRM2_23650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704485..2705108
Genome map
AA seq 207 aa AA seqDB search
MKPLPFLLAAIIVLAGIRDPLSARESVTRILFVGDSITAGFGVDPEQSYPVLVDQLLRQK
GFNNIEITNGSISGSTTASALSRLKWFLRIKPHILVLALGANDGLRGLSTVEMEQNLDRT
ILLALENGIQVILAGMEVPPNYGPRYSAAFRKVFPSLASHHNIALIPFLLKDVAGIASLN
QADGIHPNQAGQEIIATTVLPYLLDQL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttgccttttttgcttgccgcaattatcgtccttgccggcatccgtgatccc
ctgtcggcccgggaaagtgtgacccgaattctttttgtcggcgattcgattaccgcaggt
ttcggcgtcgaccctgaacagagctacccagtccttgtggatcaactgctccgccaaaag
ggatttaacaatatcgagatcaccaacgggagcatcagcggttccacaacggccagtgcc
ctttcccggctcaaatggtttttaagaattaaaccccatatcctggtgctggccctgggg
gccaatgacggattgcggggactctccaccgttgaaatggaacaaaacctggaccggacc
atcctccttgccctggaaaacggtatccaggtcattcttgcgggcatggaggtgccgccc
aattacggcccccggtattcagccgcattcagaaaggtttttccgtcccttgcaagccac
cacaacattgccttgattccttttttactaaaggatgtggcgggtattgccagcctcaac
caggcagacgggatccatcccaaccaggctgggcaggaaattattgccaccacagtgctt
ccctatctgctggatcaactgtga

DBGET integrated database retrieval system