KEGG   Desulfobacterium autotrophicum: HRM2_25240Help
Entry
HRM2_25240        CDS       T00861                                 

Gene name
rfbC1
Definition
protein RfbC1 (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:dat00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dat00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2879386..2879934
Genome map
AA seq 182 aa AA seqDB search
MKYTQLSIPEVVLITPQVFGDHRGFFMETFRDDEFKENVAHATFVQDNHSKSTQNILRGL
HYQIKHPQGKLVRVISGEVFDVAVDIRKSSPFFGRWSGATLSAENKNMLWIPPGFAHGFY
VLSNEAEFTYKCTDYYAPEHERSIRWDDPSIAIDWPIIHGTVPILSQKDKEGSTFGDAEV
FS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacccagctcagcatacccgaggttgtattgatcaccccccaagtttttggg
gaccaccggggattcttcatggaaaccttccgggacgacgaatttaaagaaaatgtagcc
catgcaacctttgtccaggacaaccacagtaaatccacccaaaacattctgaggggtctc
cactaccagatcaaacacccccagggcaaacttgtccgggtgatctcgggtgaagtcttt
gatgtggccgttgacatacgtaaatcttccccgttttttggacgctggtcaggtgcaacc
ctttcagcagaaaacaaaaatatgctatggattccaccaggatttgcccatggcttttat
gtcctgagcaatgaagcagaatttacatataaatgcactgactactatgcgccggaacac
gaaaggtccatccgatgggatgatccttccattgcaattgactggcccatcatccatggc
acagtgccaatattgtcacaaaaagataaagagggatcaacctttggtgacgcagaggtg
ttttcataa

DBGET integrated database retrieval system