KEGG   Desulfobacterium autotrophicum: HRM2_25270Help
Entry
HRM2_25270        CDS       T00861                                 

Gene name
rfbC2
Definition
protein RfbC2 (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HRM2_25270 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HRM2_25270 (rfbC2)
Enzymes [BR:dat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     HRM2_25270 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2882504..2883052
Genome map
AA seq 182 aa AA seqDB search
MEYTQLNIPDVILMEPQVFGDHRGFFMETFRDDEFKQKVVHTTFVQDNHSKSSQNILRGL
HYQIKQPQGKLVQVTSGKVFDVAVDIRKSSPFFGKWSGATLSAENKKMLWVPPGFAHGFY
VLSDEAEFTYKCTDYYAPEHERSILWNDPSIAIDWPIIHGASPILSQKDIDGVTLDKAEV
FA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaatatacccagctcaacataccggatgttattttaatggaaccccaggtattcggg
gatcaccggggattcttcatggaaacctttcgggatgacgaatttaaacaaaaggtggtc
catacaacctttgtccaggataaccacagcaaatccagccagaacattttaaggggactc
cactaccagatcaaacaaccccagggtaaacttgtccaggtgacttcaggtaaggtcttt
gatgtggcagttgatataagaaaatcttcacccttttttggaaaatggtcaggtgcaacc
ctttcagcagaaaacaaaaagatgctctgggttcccccgggttttgcccacggtttttat
gtgttaagtgatgaagcagaatttacctataaatgtacagactattatgcgcctgaacat
gaaagatccatcctgtggaatgatccttccattgccattgattggcccattatccatggt
gcatctcccatcttatctcaaaaggatatcgacggagtaaccctggacaaggctgaggta
tttgcataa

DBGET integrated database retrieval system