KEGG   Desulfobacterium autotrophicum: HRM2_27420Help
Entry
HRM2_27420        CDS       T00861                                 

Gene name
fabG6
Definition
protein FabG6 (EC:1.1.1.100)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HRM2_27420 (fabG6)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HRM2_27420 (fabG6)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HRM2_27420 (fabG6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3126940..3127854
Genome map
AA seq 304 aa AA seqDB search
MEILEPEIKQEEILILNDNNFKPANVCIVTGVGSGIGRATAIAAGANQLTVVGLDVMEEN
GEETCQLVKEMGGNMQFIRADLTRDSDMEAAVTKAATLGNIKYLANIAGIQHIDSIENFP
MERYDYMQRLMVRAPMFMAQKTIPHMKKTSDGTGAVGNMASIHAHICTLNKASYNIAKFG
LRALAQSISAEGKGKIRGFSVSTGFVKTGLALKQVAAQAQQLGITEQEVVTDIMMGFSRK
KEMMSPIDVGNLFVFGFSRFSNYLIGGDLLFDGGTVPTYANDUFFLLNAHQSIFQEAFQT
SVWP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttggaacctgaaataaaacaagaagagatattaatcctcaacgacaacaac
ttcaagccagccaatgtctgcattgtaaccggtgtcggcagcggaatcggaagggctacc
gccattgccgctggggcaaaccagttaacggttgtggggcttgatgtcatggaagaaaat
ggagaggagacctgtcagctcgttaaagaaatgggtggcaacatgcagttcatcagggct
gaccttacccgggacagcgatatggaagcggctgtaaccaaggcggcaaccctgggaaac
atcaagtacctggcaaacatagcagggattcagcacattgattccatcgagaactttccc
atggaaagatatgattacatgcaaaggctcatggtcagggcaccaatgtttatggcccaa
aaaaccatcccccacatgaaaaagaccagtgacggtacaggggctgtcgggaacatggcc
tccatccacgcccatatctgcacccttaacaaggcgtcctacaacatcgccaaatttgga
ctcagggccctggcccagtccatttcagccgaagggaaaggcaaaatccggggattttca
gtgagtacaggttttgtaaaaacaggtcttgcattaaaacaggtggcagcccaggcgcaa
cagctcgggatcacagaacaagaggtggtgaccgatatcatgatgggattttcaaggaaa
aaagagatgatgtctcccattgacgtcggcaacctgtttgtctttggtttttcaagattt
tcaaactatcttatcggcggagaccttctctttgacggtggtacggtacccacctatgcc
aatgattgattttttttattaaatgcccaccaaagcatcttccaggaggcatttcaaact
tcggtgtggccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system