KEGG   Desulfobacterium autotrophicum: HRM2_27930Help
Entry
HRM2_27930        CDS       T00861                                 

Gene name
tpi
Definition
hypothetical protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dat01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dat01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dat00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dat00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3177974..3178729
Genome map
AA seq 251 aa AA seqDB search
MSRRALIAGNWKMFKTGTEAVTTATRLVELASEVVNTDIMIAPTFLSLPLVSQAVAGSNV
KVGAQNLFYENEGAYTGEVSAAMVKAAGADYAIIGHSERRQYFGETDETVCKKIAATLKA
GLIPVLCIGETGAQRDGEKTFSVLDKQVSNGLKSFDSDALQPLVIAYEPVWAIGTGKTAT
PEQVAQVHEYIRKLVNDKFGNTLAMSIRILYGGSVKPGNVSEIMKINDVDGALVGGASLD
ADTFIKIIRYK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaagagcgttaatcgccggcaactggaaaatgttcaagaccggcacggaagcc
gttaccacggctacaagacttgttgaacttgcatctgaagttgttaatactgacatcatg
atcgcccccacctttttaagccttccccttgtatcccaggcggtggcaggatcaaatgta
aaggtcggggctcagaatctgttttatgaaaatgagggtgcctacacaggtgaagtatcc
gccgccatggtaaaggcagccggtgccgactatgccatcatcggtcattcagagcgccgc
caatattttggagaaaccgatgaaaccgtttgcaaaaagatagccgcaaccctcaaggcc
ggccttatccctgttctgtgcattggtgagaccggggcacaaagggatggggaaaaaacc
ttttccgtgcttgacaaacaggtgtcaaatgggttaaaaagctttgattctgatgcactc
cagccccttgttatcgcctatgagccggtttgggccatcggaacgggaaaaacagcaact
ccggagcaagtggcccaggtacacgaatatatccgaaagcttgttaacgataaatttggc
aacacgcttgcaatgtccatccgtatactatatggtggttcagttaagccggggaatgtt
tcggaaataatgaaaattaacgatgtcgatggcgcattggttggcggagccagccttgat
gcagatacgttcatcaaaataataaggtacaaataa

DBGET integrated database retrieval system