KEGG   Desulfobacterium autotrophicum: HRM2_28890Help
Entry
HRM2_28890        CDS       T00861                                 

Gene name
argA1
Definition
protein ArgA1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dat01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dat00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3281833..3282690)
Genome map
AA seq 285 aa AA seqDB search
MDFGQLRRGLDMGPAAARYTGLVSALRTLGHHVEDLGDVRVPVRTPVEEGEASDYIEQIR
GVCEQVYDQGRTATRENAFPLFIGGDHSIAIGTVGGVSHDRPTGLIWIDAHADFNTPVTS
PSGNIHGMPLAVLTGDGDDRLVNLGRPGAKVDLENIVMIGIRDVDRLERERLKKSGITVY
TMSDIDEQGMSTIAKKALMKLIHLKRVHLSLDIDALDPVEAPGVGTPVPGGLTFREAHLF
MEILSDSGKLTSMDLVEINPILDQANKTAKLAVDLIVSALGKSIL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggtcagcttcgcagggggcttgatatgggaccggctgctgcccgttacacg
ggccttgtatcggcccttcgcacccttggtcatcatgtggaggacctgggtgatgttcgt
gtacccgtgagaacccccgtggaagagggggaggcctccgattatatcgaacagatccgg
ggggtgtgtgaacaggtgtacgatcaaggccgaacagcaaccagggaaaatgcctttccc
ctctttatcggcggggatcattccattgccatcggaaccgtgggtggcgtgtcccacgac
cggccgaccggcctcatctggatcgatgcccatgctgattttaatacccctgtgacatcc
ccttcgggtaacattcacggcatgccccttgccgttctcacgggagacggagatgatcgc
ctggttaaccttggaaggccgggagcaaaggttgatcttgaaaacatcgtcatgataggg
atcagggatgttgacaggcttgaacgggaacggctgaaaaagagcggcattaccgtgtat
accatgagcgatattgacgagcagggcatgagcaccattgccaaaaaggccctgatgaag
ctgattcatttgaaaagggttcacctgagccttgacattgatgcccttgatcccgtggag
gccccgggtgtcggcacaccggttcctggcgggttaacctttcgggaggcccatctgttc
atggagattctttccgattcaggcaaacttacctccatggaccttgtggagattaatccc
attctggaccaggccaacaagacggcaaagcttgccgttgacctgattgtttcagccctg
ggaaagagcattttgtga

DBGET integrated database retrieval system