KEGG   Desulfobacterium autotrophicum: HRM2_29560Help
Entry
HRM2_29560        CDS       T00861                                 

Definition
putative arginine kinase (AK) (EC:2.7.3.3)
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dat00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3357468..3358484
Genome map
AA seq 338 aa AA seqDB search
MQAPSLMKQHLTPELFNELKSLQTKSGFTLERAVESGLKNPDSSVGIYAGDGESYQTFAK
IFRPVIETCHGVSIDGIHPSDLSPMDDAPPPPFNHKILSYRIRIARNIADIPFPPHVGNA
DRSRVEQLAVDALLKFEGDLKGRYFPLGELTKTQRMTFEHEHLLFGRGDRFMEAAGINRS
WPASRGIFVSNDHKFAVWINEEDHLRIISMDRPQKTPSQGIEKTYNRLARAMADLEQSLT
FACDPHLGFLTSCPSNLGTGMRAGVHVRLSGFKTRGQAIHEAAARYLLQIRGTHGEKTGV
ENDVVDISNRYRLGITEKKCVEMLQHGLEAIMTDERFS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccccctctcttatgaagcaacacttgaccccggaacttttcaatgagcttaag
agcctccagacaaagagcggatttaccctggaacgagccgttgaatctggccttaagaac
ccggattcatccgttggaatctacgctggtgatggagaatcctaccaaacgtttgccaaa
attttcagacctgtaattgagacctgccacggggtttcaattgacggcatccatccatcc
gatctgagccccatggacgatgcccccccaccaccttttaaccataaaattctttcctac
agaattcgcattgcaagaaatatagcagacattccattccccccccatgtcggcaacgct
gatcgctccagggttgaacaacttgcggttgatgcacttttaaaattcgaaggagacctc
aagggaagatatttccccctgggtgagttaaccaaaactcaaagaatgacgtttgaacac
gaacatctactgtttggacgcggggatcggttcatggaggcggcaggaatcaacaggtcc
tggcccgcttcaaggggaatttttgtatccaatgatcataaatttgccgtatggatcaat
gaggaagaccatttaagaatcatttcaatggatcgcccccagaagaccccttcacagggt
attgaaaagacatacaaccgccttgcaagggccatggcagaccttgaacaaagtttaaca
tttgcctgtgatccccacctgggatttctcacatcctgcccctccaatcttgggacagga
atgcgggccggcgtccatgtccggttatccggctttaagacacggggacaggcaatccat
gaagcagcagcgagatatctcctccagatccgggggacccatggagaaaagacaggggtt
gaaaacgatgtggtcgacatcagcaaccggtatcgactgggcataacagaaaaaaaatgc
gttgaaatgcttcagcatgggttagaggccattatgactgacgaacgtttctcctga

DBGET integrated database retrieval system