KEGG   Desulfobacterium autotrophicum: HRM2_31730Help
Entry
HRM2_31730        CDS       T00861                                 

Gene name
proB
Definition
(GenBank) ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00330  Arginine and proline metabolism
dat00332  Carbapenem biosynthesis
dat01100  Metabolic pathways
dat01130  Biosynthesis of antibiotics
dat01230  Biosynthesis of amino acids
Module
dat_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HRM2_31730 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HRM2_31730 (proB)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HRM2_31730 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACN16254
UniProt: C0QLF0
Position
3588025..3589164
Genome map
AA seq 379 aa AA seqDB search
MGTNKRLHLKNAKRVVVKIGSGVLTLNHGLNLDIIETISHQISLLQDRGCEVILVSSGAI
AAGVKKIGFKQRPEGIPARQAAAAVGQAGLIHSYDTAFARHGKQVAQLLLTRDDLGNRRR
YLNARNTINTLLDWKIVPIINENDTVVIEEIKLGDNDNLSAMITLLMDADILINLTDIDG
LFNKDPRIHPDACLIPEVTTITHQMEQAACGIPGNLGTGGMLSKLKAAKKLSKAGRPMII
AGGKNENVLSRLVDGETLGTYFLPGKKELNSKKCWIAYNLKPQGVIRLDQGARDAVITRG
KSILPIGITAVEGEFGMGAPIEIKSPDNTIIGNGLANYSSADIRRIMGLKTAAIKNVLGS
KPYDDVIHRDNLAITFELG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaataaacgcctgcatcttaaaaatgccaaacgggttgtagtcaagatcggc
agcggcgtgctgacactgaaccacggactcaaccttgatatcatcgagaccatcagtcat
cagatcagccttctccaggacaggggatgcgaagtcattctggtctcgtccggagccatt
gctgccggggtcaaaaagataggatttaaacaaaggcctgagggaattcccgcccgccag
gctgcggcagcagtcggccaggcagggttgattcactcctacgacactgcctttgcccgc
catgggaaacaggtggcccagctgctcctcacccgggacgacctgggcaaccggcgtcgc
tacctcaatgccagaaataccatcaatacccttcttgactggaaaatcgtacccatcata
aacgaaaacgacaccgttgtcatagaagagataaagctcggtgataacgataacctgtcg
gccatgatcaccctgctcatggatgcggacatcctcatcaacctcaccgacattgacgga
ctgtttaacaaggatcccagaattcacccggacgcctgtctcattcctgaggtgacgacc
atcacccaccagatggaacaggccgcctgcggtattcccggaaacctgggtaccggggga
atgctgagtaagctcaaggctgccaagaagctctcaaaagccggcagacccatgatcatt
gccggtggaaaaaacgaaaatgtcctgtccaggcttgttgacggagaaacccttggcacc
tattttctccccgggaaaaaagagctcaattccaaaaaatgctggatcgcctacaatctg
aaaccccagggagtcatccgccttgaccagggtgcaagggatgccgtcatcacccgggga
aagagtattctgcccatcgggatcacagctgttgagggcgaattcggaatgggtgcacca
attgaaatcaagtccccggacaacaccatcatcggtaacggcctggccaattactcatca
gcagacatccggcgtatcatgggactcaaaactgcggccatcaaaaacgttctcggttca
aaaccctatgatgacgtcatccaccgggataatcttgcaattacctttgaactgggatag

DBGET integrated database retrieval system