KEGG   Desulfobacterium autotrophicum: HRM2_31960Help
Entry
HRM2_31960        CDS       T00861                                 

Gene name
pncA
Definition
protein PncA (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HRM2_31960 (pncA)
Enzymes [BR:dat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     HRM2_31960 (pncA)
    3.5.1.-  
     HRM2_31960 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3625454..3626110)
Genome map
AA seq 218 aa AA seqDB search
MDMSKIPSPDARAVTGVIVVDLQGDFTTLKQGSLAVDGTDSTYVKTVEQVTLRLRAKGFT
LFATQDWHPRDHVSFFTSHPGKHPFETVEIDGLSQTLWPPHCVADSENAGILMDPSFFSM
VVKKGTCKDYDSYSGFQDQGGTSTELERLLRAGKITRLIVYGLATDYCVKATALDAAKRG
FEVFVVKDLCRGVSVDTTRAALEEMAQHGINIITMADL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtcaaaaataccaagcccggatgcccgggctgtcaccggggtgattgtcgtg
gatctccagggcgacttcaccaccctgaaacagggctcccttgccgtggacggcacggat
tcaacctatgttaaaaccgtcgagcaggtcacattgcgccttagagcaaaaggattcact
ctgttcgcaacccaggattggcacccccgggaccatgtatcgttttttaccagccacccg
ggcaaacacccctttgaaactgttgagattgatggtctctcccagaccctctggcccccc
cactgtgtggcggatagtgaaaatgccgggattctcatggacccctcctttttttccatg
gtggtaaaaaagggaacctgcaaagattacgacagctattccgggttccaggaccagggt
ggcacctccactgaactggagaggcttctccgggcgggcaagattacccggctcatcgtc
tacggccttgcaaccgattattgcgtcaaggccacagctctggatgcggcaaaaagaggg
tttgaggtgtttgttgtcaaagatctctgtcggggagtctccgtggataccacaagggcg
gccctggaagagatggctcaacacggtatcaacatcatcaccatggcagatttatag

DBGET integrated database retrieval system