KEGG   Desulfobacterium autotrophicum: HRM2_32390Help
Entry
HRM2_32390        CDS       T00861                                 

Gene name
glk
Definition
hypothetical protein (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HRM2_32390 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_32390 (glk)
   00052 Galactose metabolism
    HRM2_32390 (glk)
   00500 Starch and sucrose metabolism
    HRM2_32390 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HRM2_32390 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HRM2_32390 (glk)
   00524 Butirosin and neomycin biosynthesis
    HRM2_32390 (glk)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HRM2_32390 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3669877..3670878
Genome map
AA seq 333 aa AA seqDB search
MKSMNSDRLILAGDIGGTKTNLALYSNGRIRPVAQVIESYSSRDELNLESIVEQFFEKHP
ASISEACFAIAGPVMDGRCKTTNLPWNVSEQGIKRRFGWKVRLINDLAATALSIPLLHSR
ELHPLNTAMPRKGGNIALVAPGTGLGTSVLVWYDGKYTPIASEGGHVDFAPTDKAQALLW
RHMFEHYGHVSIERIVSGMGILNIFSYLKETGKDPAPGWLARDMERMDPARAITEAAIQK
KDPLCVKVLGMFTSILGSIAGNLALTVLATGGVYLGGGIPPKILPALADDVFMNAFTGKG
RFKDLLEKISVQVILNDRAAILGAARCALEMVI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatgaacagcgatagattgattttagccggcgatatcggagggaccaagaca
aaccttgccctctattccaatggaagaatcagaccggttgctcaggttatagaatcatat
tcgagccgggatgagctcaacctggaaagtatcgtcgaacagttttttgaaaaacacccg
gcatccatatccgaggcctgctttgccattgccggccctgtcatggatggccggtgcaag
accaccaacctgccctggaatgtttcagaacaaggtataaaacggcgtttcgggtggaag
gtacgacttatcaacgatcttgccgcaaccgccttgagcatacccctcttacatagccgt
gaactccaccctttaaacaccgccatgccccgaaaagggggtaacattgccctggttgca
ccgggcacgggtcttggaacctcggtccttgtttggtatgacggaaaatatactcctatt
gcttccgaaggcgggcatgttgattttgcccccactgacaaggcccaggcgctcctgtgg
aggcacatgttcgagcattacggccatgtaagcatcgagagaattgtatcagggatgggc
attttgaacatcttctcgtatctgaaagaaacaggaaaagatccggcccctggctggctg
gcccgggacatggagagaatggatccggcccgcgcaattacagaggccgccatacaaaaa
aaagaccctctctgcgtgaaggtcctgggcatgttcacctccatcctaggatcgatcgcc
ggaaacctcgccctcaccgttctggccaccggtggcgtctatttaggcggaggcattccc
cctaaaattttgcccgcattggctgatgacgtcttcatgaatgcctttacaggcaaagga
cgttttaaggaccttcttgaaaaaatatccgtgcaagtcatccttaatgaccgtgcagcc
atcctaggggcggcacgttgtgccttggaaatggtaatttga

DBGET integrated database retrieval system