KEGG   Desulfobacterium autotrophicum: HRM2_32390Help
Entry
HRM2_32390        CDS       T00861                                 

Gene name
glk
Definition
(GenBank) Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00010  Glycolysis / Gluconeogenesis
dat00052  Galactose metabolism
dat00500  Starch and sucrose metabolism
dat00520  Amino sugar and nucleotide sugar metabolism
dat00521  Streptomycin biosynthesis
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
Module
dat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_32390 (glk)
   00052 Galactose metabolism
    HRM2_32390 (glk)
   00500 Starch and sucrose metabolism
    HRM2_32390 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HRM2_32390 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HRM2_32390 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HRM2_32390 (glk)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HRM2_32390 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ACN16318
UniProt: C0QLL4
Position
3669877..3670878
Genome map
AA seq 333 aa AA seqDB search
MKSMNSDRLILAGDIGGTKTNLALYSNGRIRPVAQVIESYSSRDELNLESIVEQFFEKHP
ASISEACFAIAGPVMDGRCKTTNLPWNVSEQGIKRRFGWKVRLINDLAATALSIPLLHSR
ELHPLNTAMPRKGGNIALVAPGTGLGTSVLVWYDGKYTPIASEGGHVDFAPTDKAQALLW
RHMFEHYGHVSIERIVSGMGILNIFSYLKETGKDPAPGWLARDMERMDPARAITEAAIQK
KDPLCVKVLGMFTSILGSIAGNLALTVLATGGVYLGGGIPPKILPALADDVFMNAFTGKG
RFKDLLEKISVQVILNDRAAILGAARCALEMVI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatgaacagcgatagattgattttagccggcgatatcggagggaccaagaca
aaccttgccctctattccaatggaagaatcagaccggttgctcaggttatagaatcatat
tcgagccgggatgagctcaacctggaaagtatcgtcgaacagttttttgaaaaacacccg
gcatccatatccgaggcctgctttgccattgccggccctgtcatggatggccggtgcaag
accaccaacctgccctggaatgtttcagaacaaggtataaaacggcgtttcgggtggaag
gtacgacttatcaacgatcttgccgcaaccgccttgagcatacccctcttacatagccgt
gaactccaccctttaaacaccgccatgccccgaaaagggggtaacattgccctggttgca
ccgggcacgggtcttggaacctcggtccttgtttggtatgacggaaaatatactcctatt
gcttccgaaggcgggcatgttgattttgcccccactgacaaggcccaggcgctcctgtgg
aggcacatgttcgagcattacggccatgtaagcatcgagagaattgtatcagggatgggc
attttgaacatcttctcgtatctgaaagaaacaggaaaagatccggcccctggctggctg
gcccgggacatggagagaatggatccggcccgcgcaattacagaggccgccatacaaaaa
aaagaccctctctgcgtgaaggtcctgggcatgttcacctccatcctaggatcgatcgcc
ggaaacctcgccctcaccgttctggccaccggtggcgtctatttaggcggaggcattccc
cctaaaattttgcccgcattggctgatgacgtcttcatgaatgcctttacaggcaaagga
cgttttaaggaccttcttgaaaaaatatccgtgcaagtcatccttaatgaccgtgcagcc
atcctaggggcggcacgttgtgccttggaaatggtaatttga

DBGET integrated database retrieval system