KEGG   Desulfobacterium autotrophicum: HRM2_33430Help
Entry
HRM2_33430        CDS       T00861                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HRM2_33430 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HRM2_33430 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HRM2_33430 (trpA)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HRM2_33430 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3791275..3792036)
Genome map
AA seq 253 aa AA seqDB search
MLEAYIRERRRQKEILLMTHIVMGYPDFETSMAIVEQMVEAGVDLMELQIPFSEPMADGP
VILGANQAALSGGARVERCFEFARQAAAKFDIPFLFMTYYNILFKYGVTPFVNKMADINI
KGAIVPDLPPEEGQAYLKAMEEQNLSPIHIFSPRTSNERMDFLASQTRGFVYCVARKGVT
GKETRFTEEIAGYLDRCRQATTLPLAVGFGVKDEADIAFLKGKADIAVVGSEMIRVVENQ
GVEGVGRFIQSLA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagcctatattcgagaacggcgcagacaaaaggagatcctgttgatgacccac
attgtcatggggtatcctgattttgaaacatccatggctattgtcgagcagatggtcgag
gcaggcgtcgaccttatggaactccagattcccttttcagaacccatggccgacgggcct
gttattcttggtgccaatcaggcagccctttcagggggtgcgcgggttgagcgctgtttt
gagtttgcaaggcaggctgcagcaaaatttgacattccgtttttgttcatgacctattac
aatattttatttaagtacggggttacgccttttgtgaataaaatggcagacataaacatc
aagggagccattgtcccggatcttcccccggaagaggggcaggcgtatctcaaggcaatg
gaggaacagaacctttcacctatccatatcttttcgcccaggacatcaaatgagcgaatg
gattttttggcatcccagacccgcgggtttgtatactgcgtggcaagaaagggtgtgacc
ggtaaagagacccggtttaccgaagagattgcgggctaccttgaccggtgcagacaagcc
acaacccttcctttggccgttggattcggggtaaaggatgaagcggatatagcctttctc
aagggtaaggctgacattgctgttgtgggttcagaaatgatccgggtggtggaaaatcag
ggcgttgaaggggttggcaggtttatccaaagcctggcttaa

DBGET integrated database retrieval system