KEGG   Desulfobacterium autotrophicum: HRM2_33440Help
Entry
HRM2_33440        CDS       T00861                                 

Gene name
trpB
Definition
(GenBank) TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HRM2_33440 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HRM2_33440 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HRM2_33440 (trpB)
Enzymes [BR:dat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HRM2_33440 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3792029..3793255)
Genome map
AA seq 408 aa AA seqDB search
MINRGYYGTFGGAFVPEILVATFDELEREFRKIKADPAFWNEYRDLMGSYSCRPTPLTYA
ENLTKHFKGAKIYIKREDLNHTGAHKANNVMGQGLLVKRMGKTRVIAETGAGQHGVATAT
MAAKFGFDCTVYMGEVDVKRQRPNVFWMEQMGATVVPVTQGSRILKDAINEAFRDWVTNM
DTTHYVLGTACGPHPFPEMVSWFQSIIGKEARRQILEREERLPTRVYACVGGGSNAMGLF
AGFTDGDVECVGVEAAGRGIASGQHASRLCSNDASVGVAQGYKTYFLQNSDGQMNETHSI
AAGLDYVGVSPILASMHEKGEARFEAVTDTEVIEALKLTMKSEGIIPALESAHAFAQAFK
EAPAMSTNDIIIINQSGRGDKDIFTIADAIGDPSWRKFIMEKAGEYNA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaggggatattacggaacctttggcggagcttttgtacctgagattctggtt
gcaacctttgatgaactggaacgagagttcagaaaaataaaggctgatccagccttctgg
aacgagtaccgtgacctcatgggttcctactcgtgccggcccaccccgctgacctatgct
gaaaatctcacaaagcattttaaaggtgcaaaaatttacatcaagcgtgaggacctcaac
cataccggtgcccacaaggccaacaatgtcatgggccaggggcttctggtcaaacgcatg
ggcaagacccgggtgattgcggagaccggggcgggccagcacggggtggcaacggccacc
atggccgcgaagttcgggtttgactgcacggtgtacatgggggaggtggatgtcaaacgc
cagcgacccaatgtcttttggatggaacagatgggggccacggttgtgcccgtgacccag
ggctcacggattttaaaggatgccatcaacgaggcgttccgggactgggtgacgaatatg
gataccacccattacgtgctcggaacggcctgcggaccccatccctttcccgaaatggtc
agctggttccagtccatcattggaaaagaggcaagacggcaaattctggaacgggaagaa
cggcttcccacccgggtctatgcctgtgtggggggggggtcaaatgccatggggctcttt
gccggattcactgatggggatgttgaatgtgtcggggtggaggcggcaggacgcgggatc
gcctctggacagcatgcttcaaggctgtgcagcaatgatgcaagcgtcggcgttgcccag
gggtacaagacctattttctccagaacagtgacggccagatgaacgaaacccactccatt
gcggccggccttgactatgtgggggtttctccgattcttgccagcatgcacgaaaaagga
gaggcaaggtttgaggctgtgaccgacacagaggtgatcgaagcgttaaagctcaccatg
aaaagtgaaggtatcatcccggccctggagtcggcccacgcctttgcccaggcattcaag
gaggcgccggccatgtcaacgaacgatatcattatcatcaaccagtcgggtaggggagac
aaggatatttttaccattgccgacgctattggtgatccatcctggagaaaatttatcatg
gaaaaggcaggtgaatacaatgcttga

DBGET integrated database retrieval system