KEGG   Desulfobacterium autotrophicum: HRM2_33480Help
Entry
HRM2_33480        CDS       T00861                                 

Gene name
dsbC
Definition
protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dat  Desulfobacterium autotrophicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3796549..3797352)
Genome map
AA seq 267 aa AA seqDB search
MAAPCFSESVCSHVDLDWISSHISLPNDARILQMTERGELCEVVLAINGGLAPIYAGKDF
ILAGRLFKNGISLTRETLNAMSDVAEKEREKLAVKKALEKENRATFFKKNIKALDELVAL
SYNPGQARDFFYVVTDPNCSHCKDLLPKLELAAQESGMGIKVIIYPLLGDSSLDLAVQAI
CNNYSYEAYLNIKRVEPIPSCERAENLVMKTMDFFRSANLFFVPLVVAGDGSWVAESSHN
TVVRAFLGLEPLGEETGPHATCNPDLE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaccctgtttttctgaatctgtttgcagccatgtggaccttgactggatttca
agccatatttccctgcccaatgacgcaaggatacttcagatgacggagcgaggggagttg
tgtgaggttgttcttgccattaacggggggcttgcgccgatctatgcgggcaaagatttt
atactggccggtcggcttttcaaaaatggcatatcccttacccgggaaaccctgaatgcc
atgtccgatgtggctgaaaaagaacgggaaaaacttgctgtaaaaaaggctctggaaaag
gagaaccgagcaaccttttttaaaaaaaatatcaaggccctggatgaacttgtggcgctg
tcctataacccggggcaggcccgggattttttctatgtggtcactgatcccaattgttcc
cattgcaaggatcttctgcccaagcttgaattggcggcccaggagtcgggcatgggaatc
aaggtgatcatttatccccttctcggggattcaagcctggatctggctgtgcaggccatc
tgtaataattattcctatgaagcgtatctcaacattaaaagggttgaaccgattccttcc
tgcgaacgggctgagaatctggtgatgaagacaatggatttttttcggtcagccaatctt
ttctttgttcccctggtggtggcaggagacggttcatgggtggcagagtccagtcacaac
accgtggtcagagccttcctggggcttgaaccacttggggaagaaaccggtccccatgcc
acctgcaaccccgacctggaataa

DBGET integrated database retrieval system