KEGG   Desulfobacterium autotrophicum: HRM2_36520Help
Entry
HRM2_36520        CDS       T00861                                 

Gene name
cheB2
Definition
protein CheB2 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dat02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dat02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4100121..4101221
Genome map
AA seq 366 aa AA seqDB search
MERLGILVVDDTIVYRKIIGDALKEIPGVEIVGTAHNGKVALSKIKTLKPGLVTLDIEMP
EMSGIEVLEALQAIPDAPVAVMLSTLTHRGSDMTIKALELGAFDFIGKPDSGTMAENMVK
IRAALAPIIAAFRRQQQFRSMIGKRPAPGAVQPRPKTVFPEISSRAPLARNRATLSEIVG
IGISTGGPNALARMMPMLSPDLNVPILVVQHMPPMFTQSLAKSLNAKCRLTVKEAANGDP
LVPNTVYIAPGGRQMKIIAGPDGKSRNIRITDDPPENSCRPSVDYLFRSIAEHYVGRATA
VIMTGMGSDGTRGLGLMKKNGAIVIAQNKESCTVYGMPKEPIESGLADVVVPLDKIAHEI
TRTIIR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactaggaattcttgtggtagatgacaccattgtatacagaaaaatcatcggc
gatgcactaaaggagatcccaggggtcgagattgtgggtacagcccacaacggaaaagtt
gccctgtccaaaattaaaaccctcaaaccgggccttgttaccctggacattgaaatgccc
gaaatgagtggcattgaggtgctggaggcccttcaggccatcccggatgcgcccgtggct
gttatgctcagcaccctcacccacaggggaagtgacatgacgatcaaggccctggagctt
ggggcctttgactttatcggcaagccagactcaggaaccatggccgagaatatggtaaag
ataagggcggccctggcaccgatcattgctgcattcagacgccagcagcagtttcgaagt
atgataggaaaaagaccggctccaggtgcagtccagcctcggcccaaaacagttttccct
gaaatatcctcccgggccccccttgcacgaaaccgggcaaccctttccgaaattgtaggc
atcggtatttccacagggggcccaaacgcccttgcccggatgatgcccatgctctcgccc
gacctgaatgtccccatcctcgtggttcagcatatgccgccgatgtttacccagtccctt
gcaaagagtttgaatgcaaagtgccggcttacggtcaaggaagccgcaaacggtgatccc
cttgtgcccaacaccgtttacatcgccccgggtggacggcagatgaagattatcgcggga
ccggacggcaagagcagaaacatcagaataacggatgatccgcctgaaaactcctgcaga
ccctcggtggactatcttttccgatccattgccgagcactatgtgggaagggccaccgct
gtgatcatgacggggatgggctccgacggaacccggggacttggcctcatgaaaaaaaac
ggtgccattgttattgcccagaacaaggagagctgtacggtttatggaatgcctaaggag
cccattgaatccggattggcagacgttgtcgtccccctggataaaatagcccacgagata
acccgaaccataatcagatga

DBGET integrated database retrieval system