KEGG   Desulfobacterium autotrophicum: HRM2_36520Help
Entry
HRM2_36520        CDS       T00861                                 

Gene name
cheB2
Definition
protein CheB2 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dat00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HRM2_36520 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HRM2_36520 (cheB2)
Enzymes [BR:dat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HRM2_36520 (cheB2)
Two-component system [BR:dat02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   HRM2_36520 (cheB2)
Bacterial motility proteins [BR:dat02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HRM2_36520 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4100121..4101221
Genome map
AA seq 366 aa AA seqDB search
MERLGILVVDDTIVYRKIIGDALKEIPGVEIVGTAHNGKVALSKIKTLKPGLVTLDIEMP
EMSGIEVLEALQAIPDAPVAVMLSTLTHRGSDMTIKALELGAFDFIGKPDSGTMAENMVK
IRAALAPIIAAFRRQQQFRSMIGKRPAPGAVQPRPKTVFPEISSRAPLARNRATLSEIVG
IGISTGGPNALARMMPMLSPDLNVPILVVQHMPPMFTQSLAKSLNAKCRLTVKEAANGDP
LVPNTVYIAPGGRQMKIIAGPDGKSRNIRITDDPPENSCRPSVDYLFRSIAEHYVGRATA
VIMTGMGSDGTRGLGLMKKNGAIVIAQNKESCTVYGMPKEPIESGLADVVVPLDKIAHEI
TRTIIR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactaggaattcttgtggtagatgacaccattgtatacagaaaaatcatcggc
gatgcactaaaggagatcccaggggtcgagattgtgggtacagcccacaacggaaaagtt
gccctgtccaaaattaaaaccctcaaaccgggccttgttaccctggacattgaaatgccc
gaaatgagtggcattgaggtgctggaggcccttcaggccatcccggatgcgcccgtggct
gttatgctcagcaccctcacccacaggggaagtgacatgacgatcaaggccctggagctt
ggggcctttgactttatcggcaagccagactcaggaaccatggccgagaatatggtaaag
ataagggcggccctggcaccgatcattgctgcattcagacgccagcagcagtttcgaagt
atgataggaaaaagaccggctccaggtgcagtccagcctcggcccaaaacagttttccct
gaaatatcctcccgggccccccttgcacgaaaccgggcaaccctttccgaaattgtaggc
atcggtatttccacagggggcccaaacgcccttgcccggatgatgcccatgctctcgccc
gacctgaatgtccccatcctcgtggttcagcatatgccgccgatgtttacccagtccctt
gcaaagagtttgaatgcaaagtgccggcttacggtcaaggaagccgcaaacggtgatccc
cttgtgcccaacaccgtttacatcgccccgggtggacggcagatgaagattatcgcggga
ccggacggcaagagcagaaacatcagaataacggatgatccgcctgaaaactcctgcaga
ccctcggtggactatcttttccgatccattgccgagcactatgtgggaagggccaccgct
gtgatcatgacggggatgggctccgacggaacccggggacttggcctcatgaaaaaaaac
ggtgccattgttattgcccagaacaaggagagctgtacggtttatggaatgcctaaggag
cccattgaatccggattggcagacgttgtcgtccccctggataaaatagcccacgagata
acccgaaccataatcagatga

DBGET integrated database retrieval system