KEGG   Desulfobacterium autotrophicum: HRM2_36610Help
Entry
HRM2_36610        CDS       T00861                                 

Gene name
atoB3
Definition
(GenBank) AtoB3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HRM2_36610 (atoB3)
   00630 Glyoxylate and dicarboxylate metabolism
    HRM2_36610 (atoB3)
   00640 Propanoate metabolism
    HRM2_36610 (atoB3)
   00650 Butanoate metabolism
    HRM2_36610 (atoB3)
  Lipid metabolism
   00071 Fatty acid degradation
    HRM2_36610 (atoB3)
   00072 Synthesis and degradation of ketone bodies
    HRM2_36610 (atoB3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HRM2_36610 (atoB3)
   00310 Lysine degradation
    HRM2_36610 (atoB3)
   00380 Tryptophan metabolism
    HRM2_36610 (atoB3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HRM2_36610 (atoB3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_36610 (atoB3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HRM2_36610 (atoB3)
Enzymes [BR:dat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HRM2_36610 (atoB3)
Exosome [BR:dat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HRM2_36610 (atoB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4111260..4112537)
Genome map
AA seq 425 aa AA seqDB search
MKDVVIVGGVRTPVGSFGGTLKSVSVVELGAIVMKALLKRSGVRPVAGENFGPDSLDGQG
MIDLEKKGYDYDDSLQPLIIDEVIMGNVLQAGQGQNTARQAMIAAGIPRQTTAFTVNKIC
GSGLKAIALGAQAIMSGEAEVVVAGGQESMSNAPMALPKARWGHRMELTGKGEILDLMVF
DGLYEIFYGYHMGLTAENIAAKYGISRQEQDDLALLSHNRARAAIKNGTFAQEIVPVPVM
VKRQETLVDTDERPMETSLEKLAKLRPAFKKDGSVTAGNASGINDGAAAVLLMDREKANS
MGLEIYASVKAFAAGGVDPAYMGLGPVPAVRKLLKRTAMTIDDIEMVELNEAFASQAIGC
MRELKLDIERPNELGSGISLGHPIGCTGARQMVTAINQMKRKGYGTGLISMCIGGGMGMG
MIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtgatcgtagggggtgtgcgaacacccgttggttcctttggcggtacg
ttaaagagtgtgtctgttgttgaacttggggcgattgttatgaaggccctgttaaaacgt
tccggggtaaggcccgtggcaggggagaattttggaccagattccctggacggccagggc
atgattgaccttgaaaaaaaggggtatgactatgatgactcacttcagccccttatcatt
gacgaagtgatcatgggaaatgtacttcaggctggtcagggccagaatacggcccgccag
gcgatgatcgctgccgggattccccgccagaccacggcctttaccgtgaacaaaatctgc
ggatccggtctcaaggccattgccctgggggcccaggccatcatgtcgggcgaagccgaa
gttgtcgtggccggtggtcaggagagcatgagcaatgcgcccatggcccttcccaaggcc
cgctggggccaccgcatggaacttaccggcaagggtgagatccttgatctcatggtcttt
gatgggctttacgagatattttacggctaccacatggggctgaccgctgaaaacatcgcc
gcgaaatacggaatttcccgccaggagcaggatgaccttgcgcttctgagtcacaaccgg
gcccgtgctgccatcaagaatggcacctttgcccaggagattgttcctgttcccgtgatg
gtgaaacgccaggaaacccttgtggacacggatgagcggcccatggagacaagtcttgaa
aaactcgccaagctcagacccgcctttaaaaaagacggcagcgttaccgcaggcaacgct
tccggcatcaatgatggtgcggcagctgtgctgctcatggaccgggaaaaggccaatagt
atggggcttgaaatttatgcatcggtaaaagcctttgccgcaggcggtgttgatcctgcc
tacatgggccttggtcctgttcctgctgtcagaaaactcttgaaacgaaccgccatgacc
attgatgatattgaaatggttgagcttaatgaagcgtttgcatcccaggccattggttgc
atgcgggagcttaagcttgatattgaacgtcccaatgagcttggaagtggtatttccctt
ggccaccccatcgggtgcaccggtgcacgtcagatggtgacagccattaatcagatgaag
agaaaaggctatggcacaggattgatctccatgtgtatcggcggcggcatgggtatgggc
atgatcattgaacgatag

DBGET integrated database retrieval system