KEGG   Desulfobacterium autotrophicum: HRM2_38050Help
Entry
HRM2_38050        CDS       T00861                                 

Gene name
pfkA2
Definition
protein PfkA2 (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dat  Desulfobacterium autotrophicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HRM2_38050 (pfkA2)
   01230 Biosynthesis of amino acids
    HRM2_38050 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_38050 (pfkA2)
   00030 Pentose phosphate pathway
    HRM2_38050 (pfkA2)
   00051 Fructose and mannose metabolism
    HRM2_38050 (pfkA2)
   00052 Galactose metabolism
    HRM2_38050 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    HRM2_38050 (pfkA2)
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HRM2_38050 (pfkA2)
Protein phosphatases and associated proteins [BR:dat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HRM2_38050 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4271814..4272911)
Genome map
AA seq 365 aa AA seqDB search
MIKKTTKKIGIVTGGGDCPGLNAVIRALVKAGALYGWECLGIHGGFDGLLTPVKAVPLAL
KDMDGLLIRGGTILGTANSGRFSAKTGHGQTRRVPQKILDEAKTNFDAMDISALVAIGGD
GTLTIAQQMFEMGFPVVGVPKTIDNDLDATQTTFGFDTAVACAVDALDRLHSTAQSHNRV
MVLEVMGRYAGWIAAYAGLAGGADVILIPEIGFTYDSIQRKILSREAEGKHFTIVIVAEG
AAPGGKGFVTSNKTGNDREVRLGGIGHMVAMEIESQSQKETRCVVLGHLQRGGQPTQWDR
QLCTRFGVHAFQMIVQKQFGFMVALKENGMMGPVTLKDAINKIRRVDPAGELVMTARALG
ISFGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaacgacaaaaaagatcggcattgtgacagggggtggagactgtcctggc
ctgaatgcggttattagagcccttgtaaaagcgggcgcactttacggctgggaatgtctg
ggaatccatggcgggtttgacggactgctcaccccggttaaggctgtgcccctggccctt
aaagatatggacggtctgctcatccggggcggcacgatattgggcacggccaacagtggt
cgattttccgcgaaaaccggtcatggtcaaacaagacgggttccccaaaagatattggac
gaggctaaaaccaattttgatgccatggatatttctgctcttgtggccattggcggtgac
ggcacccttaccattgcccagcagatgtttgagatggggtttccggttgtgggggttccc
aagaccattgataatgatctggatgccacccagacgacctttggattcgatacggccgtg
gcctgtgctgtggatgccttggaccggcttcatagcacggcccagagccacaaccgggtc
atggttctggaagtcatgggccgatatgccggatggattgccgcctatgccggattagca
gggggggcagatgtcatattgatccccgaaattggcttcacctatgattcaatccaaaga
aaaattttgtcaagggaagcagaaggaaagcatttcaccattgttatcgttgctgaggga
gcagcccctggggggaaaggatttgtcacttcaaacaaaaccggaaatgaccgggaggtt
cgtttaggtggcatcggacacatggttgccatggaaattgaaagccaatcccaaaaagag
acccggtgtgtggttttgggacacttacagcgaggaggccagcccacccagtgggacaga
caattgtgcacaaggtttggtgttcacgccttccaaatgattgtccagaaacaatttggg
tttatggtggcattaaaggaaaatggaatgatgggcccggtcaccttgaaggatgccatc
aataaaattcgccgggtggatcctgctggagaactggtgatgacagccagggcgctgggg
atcagtttcggagattaa

DBGET integrated database retrieval system